|
|
| (9 intermediate revisions by one other user not shown) |
| Line 3: |
Line 3: |
| | ==Annotated Information== | | ==Annotated Information== |
| | ===Function=== | | ===Function=== |
| − | Please input function information here.
| + | |
| − | OsHKT2; 4 features expressed in Xenopus oocytes were then analyzed. Even in the case of very low external K + concentration is not detected OsHKT2; Ca2 + permeability capacity of 4, specific performance under high Ca2 + conditions OsHKT2; zero flow potential 4, and OsHKT2; 4 a zero flow potential and conductance lack of sensitivity to external Ca2 +. Before detected OsHKT2; 4 for Ca2 + permeability may be due to activation of Xenopus oocytes induced conductance source. Compared with Na +, OsHKT2; 4 K + permeability exhibits a high capacity (K +> Rb + ≈ Cs +> Na + ≈ Li + ≈ NH4 +). By detecting OsHKT2; 4 external pH sensitive current found in most physiological ionic conditions OsHKT2; 4 does not significantly penetrate H +. Medium further contains Na + and K + in the analysis showed that the low Na + in the external conditions, OsHKT2; 4 K + selective transporter proteins play function, but (> 10mM) are transported under high Na + Na +. These data indicate OsHKT2; 4 is K +, Na + permeability HKT transporter subfamily a new type of function. In addition, OsHKT2; 4 high K + permeability of the system to support the hypothesis that transporters involved in plant K +. | + | The family of plant membrane transporters named HKT (for high-affinity K+ transporters) can be subdivided into subfamilies 1 and 2, which, respectively, comprise Na+-selective transporters and transporters able to function as Na+-K+ symporters, at least when expressed in yeast (Saccharomyces cerevisiae) or Xenopus oocytes. Surprisingly, a subfamily 2 member from rice (Oryza sativa), OsHKT2;4, has been proposed to form cation/K+ channels or transporters permeable to Ca2+ when expressed in Xenopus oocytes. Here, OsHKT2;4 functional properties were reassessed in Xenopus oocytes. A Ca2+ permeability through OsHKT2;4 was not detected, even at very low external K+ concentration, as shown by highly negative OsHKT2;4 zero-current potential in high Ca2+ conditions and lack of sensitivity of OsHKT2;4 zero-current potential and conductance to external Ca2+. The Ca2+ permeability previously attributed to OsHKT2;4 probably resulted from activation of an endogenous oocyte conductance. OsHKT2;4 displayed a high permeability to K+ compared with that to Na+ (permeability sequence: K+ > Rb+ ≈ Cs+ > Na+ ≈ Li+ ≈ NH4+). Examination of OsHKT2;4 current sensitivity to external pH suggested that H+ is not significantly permeant through OsHKT2;4 in most physiological ionic conditions. Further analyses in media containing both Na+ and K+ indicated that OsHKT2;4 functions as K+-selective transporter at low external Na+, but transports also Na+ at high (>10 mm) Na+ concentrations. These data identify OsHKT2;4 as a new functional type in the K+ and Na+-permeable HKT transporter subfamily. Furthermore, the high permeability to K+ in OsHKT2;4 supports the hypothesis that this system is dedicated to K+ transport in the plant. |
| | | | |
| | ===Expression=== | | ===Expression=== |
| − | Please input expression information here.
| + | This gene is expressed in several cell types, including root hairs and vascular parenchyma cells. |
| | | | |
| | ===Evolution=== | | ===Evolution=== |
| − | Please input evolution information here.
| |
| | | | |
| − | You can also add sub-section(s) at will.
| + | This gene is conserved in Arabidopsis |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Please input related labs here.
| + | Southwest University |
| | + | Henan University |
| | + | Zhejiang University |
| | + | Chinese Academy of Forestry |
| | + | Fujian Agriculture and Forestry University |
| | + | Shanghai Jiaotong University |
| | + | Lanzhou University |
| | | | |
| | ==References== | | ==References== |
| − | Please input cited references here.
| + | 1. Ali Sassi;Delphine Mieulet;Imran Khan;Bertrand Moreau;Isabelle Gaillard;Hervé Sentenac;Anne-Aliénor Véry |
| | + | The Rice Monovalent Cation Transporter OsHKT2;4: Revisited Ionic Selectivity |
| | + | Plant Physiology, 2012, 160(1): 498-510 |
| | + | 2. Wen-Zhi Lan;Wei Wang;Suo-Min Wang;Le-Gong Li;Bob B. Buchanan;Hong-Xuan Lin;Ji-Ping Gao;Sheng Luan |
| | + | A rice high-affinity potassium transporter (HKT) conceals a calcium-permeable cation channel |
| | + | Proceedings of the National Academy of Sciences, 2010, 107(15): 7089-7094 |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os06g0701600|
| |
| − | Description = Cation transporter family protein|
| |
| − | Version = NM_001065020.1 GI:115469771 GeneID:4341970|
| |
| − | Length = 1749 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os06g0701600, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|
| |
| − | AP = Chromosome 6:30411807..30413555|
| |
| − | CDS = 30411816..30412011,30412120..30412350,30412435..30413537|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008399:30411807..30413555
| |
| − | source=RiceChromosome06
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008399:30411807..30413555
| |
| − | source=RiceChromosome06
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atgcctattcggctgcatatctttgtcagttctgcaaggcatgccatcaactcgtcggcattgatttgtcggttcatcgcattccatcttagcccgcttttgattcacctgtcctattttcttatcattgatgtacttggttttgttgccttggtggtgctcaggccaagcaaccacaagtacaatcctcgctatatcgatatgtttttcctatcgacatctgcagttacagtcacaggattagccaccacacaaatggaggatctttctagctctcagatagctgtcctgactctcttgatgttcttaggaagtgagatgttcctttcctttcttggccttgtccttgagtcgagcaagcaaaacaagcatgatcctgaaaaccgtagagtaagttcagttaccgtgtgtgagcagtcacatctagaagaggcaattccacaaactccatccatgaactccactgatatcaagaggagctgccacaaatacttagtgtttgtggtgttggcatacatgattattattcttgtcactggttctctattggtgttcatgtacatagctcatgtttcaagtgctagagatgtgctaacaaggaaaagcatcaacaaagctctcttctcgatatcggtcacagtctcctcatttacaaatggagggttattgccgacaaatgagagtatggctgtattctcctcaaacaatggcctcctgttgctactcatcggccagattcttgcaggcagcacactgctccctatgtttctgaggttggtgatatgggcattgagaggactaagattagcaaaagctgaagagccagacttcatgatgaacaacagcagctcagtaggtttcagtcacctgctacctaacttgcagacaatatttcttgcagctgtggaggttgcttttgtaggcatgacagtcatcctcttctgctgcttgaactgggattctgcagtgtttgcagggctaacctccctccagaagataaccaatgcattgttcatggcagtgagtgcaaggcaggcaggagaaaattccattgattgttcccttgttgcgccagcggctttagtactattcatggtcatgatgtacactccatccttgacaaagttgttctcagcatgtcaagatcacaaacaaatcggcccggaaagcgacgatagaacaagcaaggggaaaccattcctgaagacgatggcattttcaccactagccttcaacaccacagtgataatgctggtctgcatcactgaaaggagatcgatctccactgaccctctcaatttctccacatttaacatcatctttgaggtgataagtgcctacgggaacattgggttgtccactggctacagctgctcgagacagctacagcaccaggatgggattgcttgccatgagaagccatacagcttctcggggtggtggagtgaaccagggaagctgattcttgttcttgcgatgctctacgggaggctcaactcaaaggattccacaagcgcacgaactaggtga</cdnaseq>|
| |
| − | AA = <aaseq>MPIRLHIFVSSARHAINSSALICRFIAFHLSPLLIHLSYFLIID VLGFVALVVLRPSNHKYNPRYIDMFFLSTSAVTVTGLATTQMEDLSSSQIAVLTLLMF LGSEMFLSFLGLVLESSKQNKHDPENRRVSSVTVCEQSHLEEAIPQTPSMNSTDIKRS CHKYLVFVVLAYMIIILVTGSLLVFMYIAHVSSARDVLTRKSINKALFSISVTVSSFT NGGLLPTNESMAVFSSNNGLLLLLIGQILAGSTLLPMFLRLVIWALRGLRLAKAEEPD FMMNNSSSVGFSHLLPNLQTIFLAAVEVAFVGMTVILFCCLNWDSAVFAGLTSLQKIT NALFMAVSARQAGENSIDCSLVAPAALVLFMVMMYTPSLTKLFSACQDHKQIGPESDD RTSKGKPFLKTMAFSPLAFNTTVIMLVCITERRSISTDPLNFSTFNIIFEVISAYGNI GLSTGYSCSRQLQHQDGIACHEKPYSFSGWWSEPGKLILVLAMLYGRLNSKDSTSART R</aaseq>|
| |
| − | DNA = <dnaseqindica>1545..1740#1206..1436#19..1121#ctctgccctctatctccaatgcctattcggctgcatatctttgtcagttctgcaaggcatgccatcaactcgtcggcattgatttgtcggttcatcgcattccatcttagcccgcttttgattcacctgtcctattttcttatcattgatgtacttggttttgttgccttggtggtgctcaggccaagcaaccacaagtacaatcctcgctatatcgatatgtttttcctatcgacatctgcagttacagtcacaggattagccaccacacaaatggaggatctttctagctctcagatagctgtcctgactctcttgatgttcttaggaagtgagatgttcctttcctttcttggccttgtccttgagtcgagcaagcaaaacaagcatgatcctgaaaaccgtagagtaagttcagttaccgtgtgtgagcagtcacatctagaagaggcaattccacaaactccatccatgaactccactgatatcaagaggagctgccacaaatacttagtgtttgtggtgttggcatacatgattattattcttgtcactggttctctattggtgttcatgtacatagctcatgtttcaagtgctagagatgtgctaacaaggaaaagcatcaacaaagctctcttctcgatatcggtcacagtctcctcatttacaaatggagggttattgccgacaaatgagagtatggctgtattctcctcaaacaatggcctcctgttgctactcatcggccagattcttgcaggcagcacactgctccctatgtttctgaggttggtgatatgggcattgagaggactaagattagcaaaagctgaagagccagacttcatgatgaacaacagcagctcagtaggtttcagtcacctgctacctaacttgcagacaatatttcttgcagctgtggaggttgcttttgtaggcatgacagtcatcctcttctgctgcttgaactgggattctgcagtgtttgcagggctaacctccctccagaagataaccaatgcattgttcatggcagtgagtgcaaggcaggcaggagaaaattccattgattgttcccttgttgcgccagcggctttagtactattcatggtcatgatgtgagttcctctctttcaagctcttcacatttttcaggcaacaatcagaagagataacataacacggttgcttacatttctcaggtacactccatccttgacaaagttgttctcagcatgtcaagatcacaaacaaatcggcccggaaagcgacgatagaacaagcaaggggaaaccattcctgaagacgatggcattttcaccactagccttcaacaccacagtgataatgctggtctgcatcactgaaaggagatcgatctccactgaccctctcaatttctccacatttaacatcatctttgaggtgataaggtaattaagttgcacatctactcaccaaattcttcttctgatactgttcttgctccctccatgattaattcagctaatttattcatcacccattgcttctgcacacagtgcctacgggaacattgggttgtccactggctacagctgctcgagacagctacagcaccaggatgggattgcttgccatgagaagccatacagcttctcggggtggtggagtgaaccagggaagctgattcttgttcttgcgatgctctacgggaggctcaactcaaaggattccacaagcgcacgaactaggtgatgatgttat</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001065020.1 RefSeq:Os06g0701600]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |
Please input one-sentence summary here.
Annotated Information
Function
The family of plant membrane transporters named HKT (for high-affinity K+ transporters) can be subdivided into subfamilies 1 and 2, which, respectively, comprise Na+-selective transporters and transporters able to function as Na+-K+ symporters, at least when expressed in yeast (Saccharomyces cerevisiae) or Xenopus oocytes. Surprisingly, a subfamily 2 member from rice (Oryza sativa), OsHKT2;4, has been proposed to form cation/K+ channels or transporters permeable to Ca2+ when expressed in Xenopus oocytes. Here, OsHKT2;4 functional properties were reassessed in Xenopus oocytes. A Ca2+ permeability through OsHKT2;4 was not detected, even at very low external K+ concentration, as shown by highly negative OsHKT2;4 zero-current potential in high Ca2+ conditions and lack of sensitivity of OsHKT2;4 zero-current potential and conductance to external Ca2+. The Ca2+ permeability previously attributed to OsHKT2;4 probably resulted from activation of an endogenous oocyte conductance. OsHKT2;4 displayed a high permeability to K+ compared with that to Na+ (permeability sequence: K+ > Rb+ ≈ Cs+ > Na+ ≈ Li+ ≈ NH4+). Examination of OsHKT2;4 current sensitivity to external pH suggested that H+ is not significantly permeant through OsHKT2;4 in most physiological ionic conditions. Further analyses in media containing both Na+ and K+ indicated that OsHKT2;4 functions as K+-selective transporter at low external Na+, but transports also Na+ at high (>10 mm) Na+ concentrations. These data identify OsHKT2;4 as a new functional type in the K+ and Na+-permeable HKT transporter subfamily. Furthermore, the high permeability to K+ in OsHKT2;4 supports the hypothesis that this system is dedicated to K+ transport in the plant.
Expression
This gene is expressed in several cell types, including root hairs and vascular parenchyma cells.
Evolution
This gene is conserved in Arabidopsis
Labs working on this gene
Southwest University
Henan University
Zhejiang University
Chinese Academy of Forestry
Fujian Agriculture and Forestry University
Shanghai Jiaotong University
Lanzhou University
References
1. Ali Sassi;Delphine Mieulet;Imran Khan;Bertrand Moreau;Isabelle Gaillard;Hervé Sentenac;Anne-Aliénor Véry
The Rice Monovalent Cation Transporter OsHKT2;4: Revisited Ionic Selectivity
Plant Physiology, 2012, 160(1): 498-510
2. Wen-Zhi Lan;Wei Wang;Suo-Min Wang;Le-Gong Li;Bob B. Buchanan;Hong-Xuan Lin;Ji-Ping Gao;Sheng Luan
A rice high-affinity potassium transporter (HKT) conceals a calcium-permeable cation channel
Proceedings of the National Academy of Sciences, 2010, 107(15): 7089-7094
Structured Information
