|
|
| (27 intermediate revisions by one other user not shown) |
| Line 3: |
Line 3: |
| | ==Annotated Information== | | ==Annotated Information== |
| | ===Function=== | | ===Function=== |
| − | Hypothetical protein
| + | Please input function information here. |
| | | | |
| − | ===Mutation===
| |
| | ===Expression=== | | ===Expression=== |
| | Please input expression information here. | | Please input expression information here. |
| − | Editing of the orfB transcripts
| + | |
| − | (a) The fertile line
| + | ===Evolution=== |
| − | Mitochondrial RNA editing of the orfB transcript was
| |
| − | assessed in the fertile rice line. Fourteen cDNA clones
| |
| − | obtained from cDNA library of fertile rice line were
| |
| − | sequenced. Determination of the orfB cDNA sequence
| |
| − | from overlapping clones from the cDNA library showed
| |
| − | four C®T conversions within the coding region relative
| |
| − | to the orfB genomic sequence.
| |
| − | === Evolution === | |
| − | === Knowledge Extension ===
| |
| | Please input evolution information here. | | Please input evolution information here. |
| | | | |
| | You can also add sub-section(s) at will. | | You can also add sub-section(s) at will. |
| − | orfB transcripts of the sterile line have identical 3’ ends
| |
| − | with that of transcripts from the fertile lines
| |
| − | The basis of the observed differences in the orfB gene
| |
| − | transcripts between the sterile and fertile lines was
| |
| − | determined using 3’ RACE. The forward primer OGSP1
| |
| − | (Figure 4) annealed 180 bp downstream of the
| |
| − | initiation codon in the coding region of the orfB gene.
| |
| − | In both the fertile and sterile rice lines, one amplified
| |
| − | band of ~400 bp was obtained
| |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| Line 37: |
Line 18: |
| | ==References== | | ==References== |
| | Please input cited references here. | | Please input cited references here. |
| − | 1. Eckardt NA: Cytoplasmic male sterility and fertility restoration. Plant Cell
| |
| − | 2006, 18:515-517.
| |
| − | 2. Hanson MR: Plant mitochondrial mutation and male sterility. Annu Rev
| |
| − | Genet 1991, 25:461-486.
| |
| − | 3. Hanson MR, Bentolila S: Interactions of mitochondrial and nuclear genes
| |
| − | that affect male gametophyte development. Plant Cell 2004, 16:154-169.
| |
| − | 4. Schnable PS, Wise RP: The molecular basis of cytoplasmic male sterility
| |
| − | and fertility restoration. Trends Plant Sci 1998, 3:175-180.
| |
| − | 5. Chase CD, Babay-Laughnan S: Cytoplasmic male sterility and fertility
| |
| − | restoration by nuclear genes. Molecular Biology and Biotechnology of Plant
| |
| − | Organelles Springer-VerlagDaniell H, Chase CD 2004, 593-622.
| |
| − | 6. Gutierres S, Combettes B, De Paepe R: In the Nicotiana sylvestris CMSII
| |
| − | mutant, a recombination-mediated change 5’ to the first exon of the
| |
| − | mitochondrial nad1 gene is associated with lack of the NADH:
| |
| − | ubiquinone oxidoreductase (complex I) NADI subunit. Eur J Biochem
| |
| − | 1999, 216:361-370.
| |
| − | 7. Unseld M, Marienfeld JR, Brandt P, Brennicke A: The mitochondrial
| |
| − | genome of Arabidopsis thaliana contains 57 genes in 366,924
| |
| − | nucleotides. Nature Genet 1997, 15:57-61.
| |
| − | {{Mitochondrion|
| |
| − | GeneName = orfB|
| |
| − | Description = ORFB protein|
| |
| − | Version = GeneID:6450152|
| |
| − | Length = 468 bp|
| |
| − | Definition = Oryza sativa Japonica Group ''orfB'', Mitochondrion gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| + | ==Structured Information== |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Mitochondrion]] |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Mitochondrion|Mitochondrion]]|
| |
| − | AP = Mitochondrion:53424..53891|
| |
| − | CDS = 53424..53891|
| |
| − | GCID = <gbrowseImage3>
| |
| − | name=NC_011033:53424..53891
| |
| − | source=Rice_Japonica_Mitochondrion
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage3>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_011033:53424..53891
| |
| − | source=Rice_Japonica_Mitochondrion
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | AA = <aaseq>MPQLDKLTYFSQFFWLCLFFFSFYILLLNNNNGILGISRILKLRNQLLSHRGNKIRFKDPKNLEDILRKGFSTGLSYMYSSLSEVSQWCKTVDYLGKRRKITLISDFGEISGSRGMERQILYLISKSSYNTSSSRITCWKKIMLTHVLHGQGSII</aaseq>|
| |
| − | DNA = <dnaseqindica>1..468#atgcctcaacttgataaattgacttatttctcacaattcttctggttatgccttttcctctttagtttttatattctcttattaaataataataatggaatacttggaattagcagaattctcaaactacggaaccaactgctttcgcaccgggggaacaagatccgtttcaaggaccctaagaatttggaagatatctcgagaaaaggttttagcaccggtctctcatatatgtactccagtttatccgaagtatcccaatggtgtaagaccgtcgactatttgggaaaaaggaggaaaatcactctgatctcagatttcggagaaataagtggctcacgaggaatggagagacagattctctatttgatctcgaagtcctcatataacacttcttccagtcggatcacttgttggaaaaaaataatgctcacacatgttccacacgggcaaggaagcataatctaa</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/gene?term=6450152 NCBI Gene:orfB]
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]] | |
| − | [[Category:Japonica Mitochondrion]]
| |
| − | [[Category:Mitochondrion]]
| |
