Difference between revisions of "AB013448"
(→Expression) |
|||
| (5 intermediate revisions by one other user not shown) | |||
| Line 1: | Line 1: | ||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| + | Rice is a good material for studying positional cloning of disease resistance genes because its ratio of physical to genetic distance is small (100 to 300 kb/cM), and abundant genetic information is available. As a first step in cloning, the rice blast resistance gene Pi-b was finely mapped near the terminal region of chromosome 2 using restriction fragment length polymorphism (RFLP) and random amplified polymorphic DNA (RAPD) markers. Various near-isogenic lines (NILs) developed by the introgression of the indica-derived Pi-b gene into japonica recurrent parents facilitated its rapid and accurate localization and also the F2 analyses. Although Pi-b was introgressed independently from four cultivars, all the donors showed the same RFLP profile for all the nearby probes used, whereas there was some polymorphism among japonica recurrent parents, suggesting a single origin of the resistance gene. Pi-b cosegregated with RAPD (b-1) and RFLP (RZ123) markers, and it was bracketed between flanking RFLP markers at 0.5 cM on the centromeric side, and 1.9 cM on the telomeric side. The centromeric and telomeric limits of the indica regions of NILs BL-1 and BL-7 were closer to Pi-b than the flanking nucleic markers on each side, respectively, providing better (<0.5 and <1.9 cM) delineating markers. A long-range Southern blot with rare-cutter restriction enzymes revealed an 85-kb common band between the two 0-cM markers. These markers provide an excellent environment for the positional cloning of Pi-b.【5】 | ||
| + | Link = [http://www.ricedata.cn/reference/list/1419.htm]| | ||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
===Expression=== | ===Expression=== | ||
| − | The Pib gene was isolated by a map-based cloning strategy. The deduced amino acid sequence of the Pib gene product contains a nucleotide binding site (NBS) and leucine-rich repeats (LRRs); thus, Pib is a member of the NBS-LRR class of plant disease resistance genes. Interestingly, a duplication of the kinase 1a, 2 and 3a motifs of the NBS region was found in the N-terminal half of the Pib protein. In addition, eight cysteine residues are clustered in the middle of the LRRs, a feature which has not been reported for other R genes. Pib gene expression was induced upon altered environmental conditions, such as altered temperatures and darkness. | + | The Pib gene was isolated by a map-based cloning strategy. The deduced amino acid sequence of the Pib gene product contains a nucleotide binding site (NBS) and leucine-rich repeats (LRRs); thus, Pib is a member of the NBS-LRR class of plant disease resistance genes. Interestingly, a duplication of the kinase 1a, 2 and 3a motifs of the NBS region was found in the N-terminal half of the Pib protein. In addition, eight cysteine residues are clustered in the middle of the LRRs, a feature which has not been reported for other R genes. Pib gene expression was induced upon altered environmental conditions, such as altered temperatures and darkness.【3】 |
| + | Link = [http://www.ricedata.cn/reference/list/507.htm]| | ||
===Evolution=== | ===Evolution=== | ||
| − | Gene pyramiding is considered one of the most effective strategies for achieving durable resistance against blast disease (Magnaporthe oryzae B. Couch) in rice (Oryza sativa L.), although few studies have evaluated the combining effect of the resistance genes.the development of pyramided lines with two major blast resistance genes, Pish and Pib, and the evaluation of the combining effect of them. The two genes pyramided lines were selected from the progenies of a cross between one near isogenic line (NIL), which harbours Pish, and another NIL, which harbours Pib, in the genetic background of blast susceptible variety, CO 39. The presence of the resistance genes was confirmed by DNA markers linked to them. To obtain DNA markers for Pish, we genetically mapped the Pish locus. We confirmed the additive effect of Pish and Pib in the pyramided lines by their reaction patterns to blast isolates, suggesting the potential availabilities of the combinations of these genes. In addition, we provide DNA markers linked to Pish for marker aided selection in rice blast resistance breeding. | + | Gene pyramiding is considered one of the most effective strategies for achieving durable resistance against blast disease (Magnaporthe oryzae B. Couch) in rice (Oryza sativa L.), although few studies have evaluated the combining effect of the resistance genes.the development of pyramided lines with two major blast resistance genes, Pish and Pib, and the evaluation of the combining effect of them. The two genes pyramided lines were selected from the progenies of a cross between one near isogenic line (NIL), which harbours Pish, and another NIL, which harbours Pib, in the genetic background of blast susceptible variety, CO 39. The presence of the resistance genes was confirmed by DNA markers linked to them. To obtain DNA markers for Pish, we genetically mapped the Pish locus. We confirmed the additive effect of Pish and Pib in the pyramided lines by their reaction patterns to blast isolates, suggesting the potential availabilities of the combinations of these genes. In addition, we provide DNA markers linked to Pish for marker aided selection in rice blast resistance breeding.【1】Link = [http://www.ricedata.cn/reference/list/13405.htm]| |
You can also add sub-section(s) at will. | You can also add sub-section(s) at will. | ||
Latest revision as of 07:24, 25 June 2016
Contents
Annotated Information
Function
Rice is a good material for studying positional cloning of disease resistance genes because its ratio of physical to genetic distance is small (100 to 300 kb/cM), and abundant genetic information is available. As a first step in cloning, the rice blast resistance gene Pi-b was finely mapped near the terminal region of chromosome 2 using restriction fragment length polymorphism (RFLP) and random amplified polymorphic DNA (RAPD) markers. Various near-isogenic lines (NILs) developed by the introgression of the indica-derived Pi-b gene into japonica recurrent parents facilitated its rapid and accurate localization and also the F2 analyses. Although Pi-b was introgressed independently from four cultivars, all the donors showed the same RFLP profile for all the nearby probes used, whereas there was some polymorphism among japonica recurrent parents, suggesting a single origin of the resistance gene. Pi-b cosegregated with RAPD (b-1) and RFLP (RZ123) markers, and it was bracketed between flanking RFLP markers at 0.5 cM on the centromeric side, and 1.9 cM on the telomeric side. The centromeric and telomeric limits of the indica regions of NILs BL-1 and BL-7 were closer to Pi-b than the flanking nucleic markers on each side, respectively, providing better (<0.5 and <1.9 cM) delineating markers. A long-range Southern blot with rare-cutter restriction enzymes revealed an 85-kb common band between the two 0-cM markers. These markers provide an excellent environment for the positional cloning of Pi-b.【5】 Link = [1]|
Expression
The Pib gene was isolated by a map-based cloning strategy. The deduced amino acid sequence of the Pib gene product contains a nucleotide binding site (NBS) and leucine-rich repeats (LRRs); thus, Pib is a member of the NBS-LRR class of plant disease resistance genes. Interestingly, a duplication of the kinase 1a, 2 and 3a motifs of the NBS region was found in the N-terminal half of the Pib protein. In addition, eight cysteine residues are clustered in the middle of the LRRs, a feature which has not been reported for other R genes. Pib gene expression was induced upon altered environmental conditions, such as altered temperatures and darkness.【3】 Link = [2]|
Evolution
Gene pyramiding is considered one of the most effective strategies for achieving durable resistance against blast disease (Magnaporthe oryzae B. Couch) in rice (Oryza sativa L.), although few studies have evaluated the combining effect of the resistance genes.the development of pyramided lines with two major blast resistance genes, Pish and Pib, and the evaluation of the combining effect of them. The two genes pyramided lines were selected from the progenies of a cross between one near isogenic line (NIL), which harbours Pish, and another NIL, which harbours Pib, in the genetic background of blast susceptible variety, CO 39. The presence of the resistance genes was confirmed by DNA markers linked to them. To obtain DNA markers for Pish, we genetically mapped the Pish locus. We confirmed the additive effect of Pish and Pib in the pyramided lines by their reaction patterns to blast isolates, suggesting the potential availabilities of the combinations of these genes. In addition, we provide DNA markers linked to Pish for marker aided selection in rice blast resistance breeding.【1】Link = [3]|
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
1. Y. Koide;A. Kawasaki;M. J. Telebanco-Yanoria;A. Hairmansis;N. T. M. Nguyet;J. Bigirimana;D. Fujita;N. Kobayashi;Y. Fukuta. Development of pyramided lines with two resistance genes, Pish and Pib, for blast disease (Magnaporthe oryzae B. Couch) in rice (Oryza sativa L.),Plant Breeding, 2010, 129(6): 670-675
2. 刘洋;徐培洲;张红宇;徐建第;吴发强;吴先军.水稻抗稻瘟病Pib 基因的分子标记辅助选择与应用.中国农业科学, 2008, 41(1): 9-14
3. Zi-Xuan Wang;Masahiro Yano;Utako Yamanouchi;Masao Iwamoto;Lisa Monna;Hiroshi Hayasaka;Yuichi Katayose and Takuji Sasaki.The Pib gene for rice blast resistance belongs to the nucleotide binding and leucine-rich repeat class of plant disease resistance genes.The Plant Journal, 1999, 19(1): 55-64
4. L. Monna;A. Miyao;H. S. Zhong;M. Yano;M. Iwamoto;Y. Umehara;N. Kurata;H. Hayasaka;T. Sasaki.Saturation mapping with subclones of YACs: DNA marker production targeting the rice blast disease resistance gene, Pi-b,Theoretical and Applied Genetics, 1997, 94(2): 170-176
5. Masaru Miyamoto;Ikuo Ando;Krystyna Rybka;Osamu Kodama;Shinji Kawasaki.High Resolution Mapping of the Indica-Derived Rice Blast Resistance Genes. I. Pi-b.Molecular Plant-Microbe Interactions, 1996, 9(1): 6-13
Structured Information
| Gene Name |
AB013448 |
|---|---|
| Description |
10322 bp DNA linear PLN 15-FEB-2008. |
| Version |
AB013448.1 GI:4521189 |
| Length |
10322 bp |
| Definition |
Oryza sativa Japonica Group gene for Pib, complete cds. |
| Source |
Oryza sativa Japonica Group (Japanese rice) ORGANISM Oryza sativa Japonica Group Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 2:2293..9202 |
| Sequence Coding Region |
2293..9202 |
| Expression | |
| Genome Context |
{{{GCID}}} |
| Gene Structure |
{{{GSID}}} |
| Coding Sequence |
{{{CDNA}}} |
| Protein Sequence |
<aaseq>MEATALSVGKSVLNGALGYAKSAFAEEVALQLGIQKDHTFVADE LEMMRSFMMEAHEEQDNSKVVKTWVKQVRDTAYDVEDSLQDFAVHLKRPSWWRFPRTL
LERHRVAKQMKELRNKVEDVSQRNVRYHLIKGSAKATINSTEQSSVIATAIFGIDDAR
RAAKQDNQRVDLVQLINSEDQDLKVIAVWGTSGDMGQTTIIRMAYENPDVQIRFPCRA
WVRVMHPFSPRDFVQSLVNQLHATQGVEALLEKEKTEQDLAKKFNGCVNDRKCLIVLN
DLSTIEEWDQIKKCFQKCRKGSRIIVSSTQVEVASLCAGQESQASELKQLSADQTLYA
FYDKGSQIIEDSVKPVSISDVAITSTNNHTVAHGEIIDDQSMDADEKKVARKSLTRIR
TSVGASEESQLIGREKEISEITHLILNNDSQQVQVISVWGMGGLGKTTLVSGVYQSPR
LSDKFDKYVFVTIMRPFILVELLRSLAEQLHKGSSKKEELLENRVSSKKSLASMEDTE
LTGQLKRLLEKKSCLIVLDDFSDTSEWDQIKPTLFPLLEKTSRIIVTTRKENIANHCS
GKNGNVHNLKVLKHNDALCLLSEKVFEEATYLDDQNNPELVKEAKQILKKCDGLPLAI
VVIGGFLANRPKTPEEWRKLNENINAELEMNPELGMIRTVLEKSYDGLPYHLKSCFLY
LSIFPEDQIISRRRLVHRWAAEGYSTAAHGKSAIEIANGYFMELKNRSMILPFQQSGS
SRKSIDSCKVHDLMRDIAISKSTEENLVFRVEEGCSAYIHGAIRHLAISSNWKGDKSE
FEGIVDLSRIRSLSLFGDWKPFFVYGKMRFIRVLDFEGTRGLEYHHLDQIWKLNHLKF
LSLRGCYRIDLLPDLLGNLRQLQMLDIRGTYVKALPKTIIKLQKLQYIHAGRKTDYVW
EEKHSLMQRCRKVGCICATCCLPLLCEMYGPLHKALARRDAWTFACCVKFPSIMTGVH
EEEGAMVPSGIRKLKDLHTLRNINVGRGNAILRDIGMLTGLHKLGVAGINKKNGRAFR
LAISNLNKLESLSVSSAGMPGLCGCLDDISSPPENLQSLKLYGSLKTLPEWIKELQHL
VKLKLVSTRLLEHDVAMEFLGELPKVEILVISPFKSEEIHFKPPQTGTAFVSLRVLKL
AGLWGIKSVKFEEGTMPKLERLQVQGRIENEIGFSGLEFLQNINEVQLSVWFPTDHDR
IRAARAAGADYETAWEEEVQEARRKGGELKRKIREQLARNPNQPIIT</aaseq>
|
| Gene Sequence |
<dnaseqindica>1..61#121..181#241..301#361..421# 481..541#601..661#721..781#841..901#961..1021#1081..1141#1201..1261#1321..1381#1441..1501#1561..1621#1681..1741#1801..1861#1921..1981#2041..2101#2161..2221#2281..2341# 2401..2461#2521..2581#2641..2701#2761..2821#2881..2941#3001..3061#3121..3181#3241..3301#3361..3421#3481..3541#3601..3661#3721..3781#3841..3901#3961..4021#4081..4141#4201..4261# 4321..4381#4441..4501#4561..4621#4681..4741#4801..4861#4921..4981#5041..5101#5161..5221#5281..5341#5401..5461#5521..5581#5641..5701#5761..5821#5881..5941#6001..6061#6121..6181# 6241..6301#6361..6421#6481..6541#6601..6661#6721..6781#6841..6901#6961..7021#7081..7141#7201..7261#7321..7381#7441..7501#7561..7621#7681..7741#7801..7861 #7921..7981#8041..8101#8161..8221#8281..8341#8401..8461#8521..8581# 8641..8701#8761..8821#8881..8941#9001..9061#9121..9181#9241..9301#9361..9421#9481..9541#9601..9661#9721..9781#9841..9901#9961..10021#10081..10141#10201..10261#10321# cggccgcata atacgactca ctatagggat ctcctctaga gttactttgc cgtgctccat actatcctat tctatattgg attatactat cgatccaacg attcagatta actctatact agtgaagtct acacttatgg tatgggtaat atacatatgt agtatagtat agcataaggg tatttcattt tgcaggttag ccgtttatct gctggtgctc ctcttgctgt agtagtgttg ttggtgttgc tgctgatgac ctaaaatgct tgcatgtttc tatcatgttc tccataatgt agtatcatgt actccatctt ccttgttggt ttttgtccat aatctccacc ttggcagctt gcatcatctt actctcgagc ttgtccacct tgagattcaa ctcctggaac gcggctccca gttcatccac cctcttctcc acggcaggaa tccgtgactc caccgtacgc ttgagatctt ggtactccgc cctggtgcgc tcatcagcct caactcgttt cttctcattc ccttccacaa gttgcagaag gaggtccaac ttcttatcag tctccatggc ctcggatctg gatcaggtac ctactgctct cgctccgaat tccgcgaacc ttagggggca agtttccttt tcgcggtgcc gatccgaaga tcagctccaa tccaccccaa ggaacaattt caccgcagaa tcaagagaat ttgagaagca agagaggctc tgataccaga ttgtcaggat ctcaagaaat cagcaaagaa caacaagaac acacaaggat tcaggcaact agtttggatt gatctgctcc aacccaacag gattgagcct tccgccgcca ccgccaccga gttgccagtt catagttgtc tttctcgagt tcatcttatt tatacagtag tatctcccta ctcacacgac acacacagta gccagctgta caacagatag ctgggctacg caacccactc ggacccatgg taacgaggat tgggctttgg ccctcttgtg ggtcttgctc ttcctggagt agtagtctgt atctcctcct cctggacttc agcttctgct tcatcaggtt ctccttcttc aggttccttc tctccctgtt cagcttctgc ttcatcaggt tctccttctt cagtacccat agtgacaggc aggttcctga caaaattctg ctcgtttgcg accaatggta gtgatcatag ttgcaaccag gagggggggg ggggaaatcg ccgtcccctc cgctcctctc ccgtcgtccc caacgcctcg ttcgcgcatt tcgttgaaca ccatgacggc gccgaattcg cagtgtccgc acatctcctc ctcccccgtc ctctccaaac cccaaaccct atctccaccc ccgaggcagg cgcccccatg cacttgtaag tcgattggat gtcctgtccc agaagacata tcgagcgagg aggcggaggg ggacgaaggg aacatatcga gcgaggaagc ggagggtgga tcggcatccc ccatttcaag gtactatact agtccattat agtagtagtg cttttgcatc ttagaaaaaa aaatatgttc attagccatt gagagcttct gaagttgttg attttgttcc aaccccaact gtgagtttca gttcaggtca tccactgatt ttcactatgc caattctctg aaacaacttt accactgtca catgaacaca ctgaaacagt ttggtgtaga cgtgtagtga agaatgtagc atatatacct tcacttaatt tttcttgcaa ttattggcca ttactagtta tgcgaggtag aagtgttcta aggtactgta tcatttttat gtactaatta attaagttta ataaaaactt ttattatcta aaaataaatg actattacta gctcggtact ccctttattt tatattataa gacgttttga tttttttata tacaactttc tttaagtttg attatactta taaaaaatta gcaaacatat atattttttt tacattaata gtgcaagtga gcacgcttaa atgcattgta cttccttcgt aaaaaaacat caaactttta cggacgaata tggataaatg catatctaaa ttcatcctca ataattgatt ctttttggag gagtacaatt ggttggtgcg ctttgtcctt ggaccctaca ataatgatga ttgtttcttt aatctattga ccttgactta ccacatgggc tatgtttatc ccttcctgaa tcctgagcac tgactaccga ggcaccgagt gtgagcggca acggcggtca gggagcaggc gtggctcgtc ggcgagcggc tacgggcaac ggcgccttgg cgtcaggcat ccgccgtcac tcacctcaag cttgcgggct ctgcgaccac cctctcatag tcataggcca cagaaggtgt agtagtactt catacatttc gagcagtttc tttcagattg tttgtttttg agcttctaat tttgggatgc attagatagt gatgaaagcc tgaattattg gaattttggt gttggtactc acactctcac agtcagaaca tactcctata tattttgcag cacatttgcc ttgtgcgtgc tgttcgtctg ttccactcgt gaacatcaga cgcgaagatt atagattcac ccctgttcac agattcaggt actgccaatt gcctggatga acaccagtcc atttgctctc tttcgcctta caatttttct ctgcattgta ctagcagccg tagctcgaaa gcctcgaata tgattccttt tcaagatttt atatttatgg aatataattc acttttaaga tgccttgatg gtgaaatagt agacatgtga gactccaaat ctcgtcctaa aagagcatgg aggtaaaaaa agaaaaaggt agacatcgct attgtagaca tggagagctg gaatacgatt actttcaaga tattatattc aatgagcatt cattcttaca catatgccac aaaggtaaaa aaaaacagag aaagagagag agaggggaaa gaagccaagt tctttcttct actatcattt aggttgagtt cgtttgttaa ggttcccaac ctacgattcc tcgtttcccg cgtgcacgat tcccaaacta ctaaatggta tgctttttaa aatatttcgt agaaaaattg ctttaaaaaa tcatattaat ttatttttta agttgtttag ctaatactca attaatcatg cattaatttg ccgctccgtt ttagtggaag tcatctgaaa ggatcaaagg aagcaacacc aagtccttat ttcgactccg actctctcac tctcgccatt tattcttttc tttctgttat tttaaaagtt gctactttag cttcagccac gtgaattctt gatatttcat tatttttctc atcaaacaat agcatcttct tctggaaatc gaattcaggg cttatatgtt gcttattctg atatataggt ctgtcacgag gcgtatgatc atcaactctg ccacaaaatc cattcaaaaa tagaacagag caatggaggc gacggcgctg agtgtgggca aatccgtgct gaatggagcg cttggctacg caaaatctgc atttgctgag gaggtggcct tgcagcttgg tatccagaaa gaccacacat ttgttgcaga tgagcttgag atgatgaggt ctttcatgat ggaggcgcac gaggagcaag ataacagcaa ggtggtcaag acttgggtga agcaagtccg tgacactgcc tatgatgttg aggacagcct ccaggatttc gctgttcatc ttaagaggcc atcctggtgg cgatttcctc gtacgctgct cgagcggcac cgtgtggcca agcagatgaa ggagcttagg aacaaggtcg aggatgtcag ccagaggaat gtgcggtacc acctcatcaa gggctctgcc aaggccacca tcaattccac tgagcaatct agcgttattg ctacagccat attcggcatt gacgatgcaa ggcgtgccgc aaagcaggac aatcagagag tggatcttgt ccaactaatc aacagtgagg atcaggacct aaaagtgatc gcggtctggg gaacaagtgg tgatatgggc caaacaacaa taatcaggat ggcttatgag aacccagatg tccaaatcag attcccatgc cgtgcatggg taagggtgat gcatcctttc agtccaagag actttgtcca gagcttggtg aatcagcttc atgcaaccca aggggttgaa gctctgttgg agaaagagaa gacagaacaa gatttagcta agaaattcaa tggatgtgtg aatgatagga agtgtctaat tgtgcttaat gacctatcca ccattgaaga gtgggaccag attaagaaat gcttccaaaa atgcaggaaa ggaagccgaa tcatagtgtc aagcactcaa gttgaagttg caagcttatg tgctgggcaa gaaagccaag cctcagagct aaagcaattg tctgctgatc agacccttta cgcattctac gacaaggtaa tatacttgct cttcaagcat acctctcgat atcattttta attcagttat gcctttagta atttctaatt caattgtgta taggctagtt gaagtgcgtg ggagttacca ttccattaga aacacatgac ctaatgcaac taacaagtgc tcctcctgtt ctctctcatt tgccttttgg gaatgcatgc actcaacatt ttaagattac agccaaaata tatgtatttg gatttgtcaa aacaaagatg tatgctagaa aaagaaatgg tctaatacag gtttacaaat aagacaacga tgcaaaaagg gcaactaaaa acatattgat tccctcatct gccactgcaa ttgccttaaa ttctagtcca ttctactatc tccgtttcat attataagtc actctagttt ttttccagtc aaacttcttt agtttgacca agtttataca aaaatttagc aacatatcca acacgaaatt agtttcatta aatgtagcat tgaatatatt ttgatagtat gtttgttttg tgttgaaaat gctgctatat tttttaaaaa aacttggtca aacctaaaca agtttgacta ggagaaaagt cgaaacgact tataatatga aatagaggga gaatgttcga agtttggcta acggtcaatg ctagtgcttt aagtgggtaa gccgcaaatc caattatagg ccaaaataca tgggtttgtg gcttattttg gctataagtg ggtttcgcgg gttagccact tacaccccta gtcaatgcta atgaaagtag aagtgatgct attcaaggaa aatgtattgg ataccgagat tgccttgaat aaagaataaa attgaggtag tagattggat aatagattga cccacaaaat tgtacaagta tgtaatgtag cacaagtcct ctttgcacaa ttaaaatttt gaagctccta tttcacaaat aattttgata tggattaatt gatttcatat ccaattcgca cagtttattg aatttggaga tttatttcct ctatatgtga gagatgattg taaaatgggc aaatctagca aatgcatcct ctcatccttt ggattaaatg tagtgtactt atcccattat tttaaagtta aattaataca tattttattg aacagtcaga tatacgtttt tcaaaatagg atccaaaact aaggtttata ctagactgca aattaatgaa aggaattatc attattgttt tgtatacttt catgaccgaa aacaaggcta aacactatcc atgtatgaaa atttaaggct aaaagttgtt cttaatcatt gctccctttt gtttagggtt cccaaattat agaggattca gtgaagccag tgtctatctc ggatgtggcc atcacaagta caaacaatca tacagtggcc catggtgaga ttatagatga tcaatcaatg gatgctgatg agaagaaggt ggctagaaag agtcttactc gcattaggac aagtgttggt gcttcggagg aatcacaact tattgggcga gagaaagaaa tatctgaaat aacacactta attttaaaca atgatagcca gcaggttcag gtgatctctg tgtggggaat gggtggcctt ggaaaaacca ccctagtaag cggtgtttat caaagcccaa ggctgagtga taagtttgac aagtatgttt ttgtcacaat catgcgtcct ttcattcttg tagagctcct taggagtttg gctgagcaac tacataaagg atcttctaag aaggaagaac tgttagaaaa tagagtcagc agtaagaaat cactagcatc gatggaggat accgagttga ctgggcagtt gaaaaggctt ttagaaaaga aaagttgctt gattgttcta gatgatttct cagatacctc agaatgggac cagataaaac caacgttatt ccccctgttg gaaaagacaa gccgaataat tgtgactaca agaaaagaga atattgccaa ccattgctca gggaaaaatg gaaatgtgca caaccttaaa gttcttaaac ataatgatgc attgtgcctc ttgagtgaga aggtaatata agtgtgctcc atttttcttg gtttgatatt cttttaatca tttgagttat ccaatcaaga tgatatttgt gcatgcagaa atagcatata ctagattcat atacaactta atctgttctc acaacaatag caatgcagtt cctaaaatga cctgcattgg atggacgtta gatgtgactt tgtttttgta tgtaatggtg gccttcattc cttagtttta atagtaaaga cgtatttcta aatttaattt tttttgtttt actttagagc acaataaagc ttaaattgta tcaatgtcag gtatttgagg aggctacata tttggatgat cagaacaatc cagagttggt taaagaagca aaacaaatcc taaagaagtg cgatggactg ccccttgcaa tagttgtcat aggtggattc ttggcaaacc gaccaaagac cccagaagag tggagaaaat tgaacgagaa tatcaatgct gagttggaaa tgaatccaga gcttggaatg ataagaaccg tccttgaaaa aagctatgat ggtttaccat accatctcaa gtcatgtttt ttatatctgt ccattttccc tgaagaccag atcattagtc gaaggcgttt ggtgcatcgt tgggcagcag aaggttactc aactgcagca catgggaaat ctgccattga aatagctaac ggctacttca tggaactcaa gaatagaagc atgattttac cattccagca atcaggtagc agcaggaaat caattgactc ttgcaaagtc catgatctca tgcgtgacat cgccatctca aagtcaacgg aggaaaacct tgtttttagg gtggaggaag gctgcagcgc gtacatacat ggtgcaattc gtcatcttgc tataagtagc aactggaagg gagataagag tgaattcgag ggcatagtgg acctgtcccg aatacgatcg ttatctctgt ttggggattg gaagccattt tttgtttatg gcaagatgag gtttatacga gtgcttgact ttgaagggac tagaggtcta gaatatcatc accttgatca gatttggaag cttaatcacc taaaattcct ttctctacga ggatgctatc gtattgatct actgccagat ttactgggca acctgaggca actccagatg ctagacatca gaggtacata tgtaaaggct ttgccaaaaa ccatcatcaa gcttcagaag ctacagtaca ttcatgctgg gcgcaaaaca gactatgtat gggaggaaaa gcatagttta atgcagaggt gtcgtaaggt gggatgtata tgtgcaacat gttgcctccc tcttctttgc gaaatgtatg gccctctcca taaggcccta gcccggcgtg atgcgtggac tttcgcttgc tgcgtgaaat tcccatctat catgacggga gtacatgaag aggaaggcgc tatggtgcca agtgggatta gaaaactgaa agacttgcac acactaagga acataaatgt cggaagggga aatgccatcc tacgagatat cggaatgctc acaggattac acaagttagg agtggctggc atcaacaaga agaatggacg agcgtttcgc ttggccattt ccaacctcaa caagctggaa tcactgtctg tgagttcagc agggatgccg ggcttgtgtg gttgcttgga tgatatatcc tcgcctccgg aaaacctaca gagcctcaag ctgtacggca gtttgaaaac gttgccggaa tggatcaagg agctccagca tctcgtgaag ttaaaactag tgagtactag gctattggag cacgacgttg ctatggaatt ccttggggaa ctaccgaagg tggaaattct agttatttca ccgtttaaga gtgaagaaat tcatttcaag cctccgcaga ctgggactgc ttttgtaagc ctcagggtgc tcaagcttgc aggattatgg ggcatcaaat cagtgaagtt tgaggaagga acaatgccca aacttgagag gctgcaggtc caagggcgaa tagaaaatga aattggcttt tctgggttag agtttctcca aaacatcaac gaagtccagc tcagtgtttg gtttcccacg gatcatgata ggataagagc cgcgcgcgcc gcgggcgctg attatgagac tgcctgggag gaagaggtac aggaagcaag gcgcaaggga ggtgaactga agaggaaaat ccgagaacag cttgctcgga atccaaacca acccatcatt acctgagctc ctttggagtt actttgccgt gctccatact atcctacaag tgagatcctc tgcagtactg catgctcact gacatgtgga cccgaggggc tgtggggccc acatgtcagt gagcagtact gtgcagtact gcagaggacc tgcatccact atcctatatt ataatggatt gtactatcga tccaactatt cagattaact ctatactagt gaacttattt ttttttgccg ggccggcaaa tagctggtcg atgtatatta agaataagaa agggaatgta caagatagcg cggtgcgtca atgcaccacc attacagacg taaaaggaaa gctaaaatct cacagaatga gttgctacag agtgacacat ggggctaaca agacctgcag ctatccaagt ctcccattca tcccccatgg cagaacagaa ctggggaacc gttgccgcga tcccttcaaa cacccttgcg tttcgctctt tcgaaatcaa ccaggttaca aggatcaccc ttgcatcgaa cgttttgcgg tcaaccttag caacagattt ccgggctgca agccaccaat cagcaaaatc agccgacgat gaggagcacg aaaggaccag gcgtgtgcgc acctgacctc aaatctcctg ggtgtaagag cagcccacga agatgtgctg gcaggtttcc ccgtcattgg agcagaaata gcacaccgga gcaagcttcc atctgtgacg ttgtagattg ttggcagtga ggcaagcatt gcgctcggcg agaaacataa agaacttaca tctcgccggg gcaagagact tccaaataat ggtatacata tgtagtatat agtatagtat agtatagtat aagggtattc attttgcagg ttagcggtta tctgctgctg ttcctcctgc tgcggcgtgc tggagtagtg ttgttggtgg tggtgctgat gacctaaaat gcttgcttgt ttctatcaag ttctccagaa tgtagtatgt actgcatctt gttgattttt gtccataaac ggattgcatt atctgtatat gacccaatca acaataaacg gtgttgcatt ttgttcctaa aagctcttag agtctgacca gttatctctg tacgcatctt catgctgttc tttgggcact ggtcatggtt aaatcacagt tcaccgaaac ttattttctg tagacttatt ctgaaatact gagaaattga aatgtagtaa ctattgtctg tagactgctt tctcgttttt cttttgcggt cgccatctcc agtcagtatc tacagaagaa gagccaatgc agcctattgt cctttttttg ccgggtcggc cg</dnaseqindica> |
| External Link(s) |