|
|
| (4 intermediate revisions by one other user not shown) |
| Line 2: |
Line 2: |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | The gene osMGD is isolated from the submergence tolerant cultivar FR13A. |
| | ===Function=== | | ===Function=== |
| | | | |
| | OsMGD play an important role in coping various stresses for plants, which also provide us a possible approach to enhance plant multiple stresses tolerance.The enhanced expression of OsMGD may relate to photosynthesis, and play an important role during submergence. | | OsMGD play an important role in coping various stresses for plants, which also provide us a possible approach to enhance plant multiple stresses tolerance.The enhanced expression of OsMGD may relate to photosynthesis, and play an important role during submergence. |
| − | The full length of OsMGD cDNA was amplified using 5'- and 3'-rapid amplification of cDNA ends, and found to consist of 1,671 bp with an open reading frame of 1,077 bp (181-1257) encoding 358 amino acids.
| + | The full length of OsMGD cDNA was amplified using 5'- and 3'-rapid amplification of cDNA ends, and found to consist of 1,671 bp with an |
| | + | open reading frame of 1,077 bp (181-1257) encoding 358 amino acids. |
| | + | The overexpression of OsMGD improves salt tolerance in tobacco and that galactolipids, MGDG and DGDG play an important role in the regulation of chloroplast structure and function in the plant salt stress response. |
| | | | |
| | ===Expression=== | | ===Expression=== |
| Line 17: |
Line 20: |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Please input related labs here.
| + | Laboratory of Plant Biotechnology, Faculty of Agriculture, Tottori University, Koyama-cho, Minami 4-101, |
| | + | Tottori 680-8553, Japan. |
| | + | Plant Breeding Division, Bangladesh Institute of Nuclear Agriculture (BINA), Bangladesh Agricultural University Campus, Mymensingh-2202, Bangladesh. |
| | + | State Key Laboratory of Soil Erosion and Dryland Farming on the Loess Plateau,Institute of Soil and Water Conservation, Northwest A&F University, |
| | + | Faculty of Agriculture, Tottori University. |
| | + | Laboratory of Plant Biotechnology, Faculty of Agriculture, Tottori University, Koyama, Tottori, 680-8553, Japan. |
| | + | Institute of Biotechnology, Zhejiang University, Huajiachi Campus, Hangzhou, 310029, People’s Republic of China |
| | | | |
| | ==References== | | ==References== |
| | Please input cited references here. | | Please input cited references here. |
| | + | Cloning of a putative monogalactosyldiacylglycerol synthase gene from rice (Oryza sativa L.) plants and its expression in response to submergence and other stresses.Yanhua Qi, Yasuo Yamauchi, Jianqun Ling, Naoyoshi Kawano, Debao Li, Kiyoshi Tanaka Planta, 2004, 219(3): 450-458. |
| | + | Maintenance of chloroplast structure and function by overexpression of the OsMGD gene leads to enhanced salt tolerance in tobacco. Shiwen Wang,Md. Imtiaz Uddin, Kiyoshi Tanaka, Lina Yin, Zhonghui Shi,Yanhua QiJun'ichi Mano,Kenji Matsui,Norihiro Shimomura,Takeshi Sakaki5,Xiping Deng1and Suiqi Zhang1. |
| | + | Expression and subcellular localization of antiporter regulating protein OsARP in rice induced by submergence, salt and drought stresses. Md Imtiaz Uddin1, Maki Kihara1, Lina Yin, Mst Farida Perveen and Kiyoshi Tanaka. |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]] |
| − | GeneName = Os02g0802700|
| |
| − | Description = Similar to MGDG synthase type A|
| |
| − | Version = NM_001054958.1 GI:115449286 GeneID:4331045|
| |
| − | Length = 4212 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os02g0802700, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
| |
| − | AP = Chromosome 2:35110098..35114309|
| |
| − | CDS = 35110099..35110336,35110863..35110890,35111867..35112028,35112130..35112271,35112688..35112912<br>,35113017..35113079,35113185..35113259,35113566..35113853|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008395:35110098..35114309
| |
| − | source=RiceChromosome02
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008395:35110098..35114309
| |
| − | source=RiceChromosome02
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>ctcgcctccccaattttaaactcccttctctctctctctcgtcgtcgtcgtccaccgccgcaaaggggtctcgtctctctcgggggcgatggcggcgtcgtcgtcgtcgtcgtcgtcgatggcgtcgccgagggggaggtcgatccgggagacggtgctggagacggtggcggcgtaccaccagcagcagaggatgaggcgcaagttcaggaagagcctctcctacgcgggggagctgtcgccgcgctcgcctcattctatgccaagaaggttgaggctggactcaagaagtacaaaccagatattataattagtgtccaccccctcatgcaacacattcctctatgggtactcaaatggcaagggctacaaaatagagtggtctttgtcactgtcatcacagacctcaacacttgtcaccctacatggttccatgctgatgtcaatagatgttactgcccatcggaagaagttgccaagagagcagcactggatgacctacaaccttctcaaatccgtgtgtttggccttccgattcggccatcattctgccgagccgttcttgttaaggatgatttgaggaaggaacttgaattggatcctgagctgcctgcagtattgctgatgggaggtggagagggcatgggtcctgtcaagaagaccgcaaaagcccttggagagtcgttgtttgacaaggagcttggaaaaccaattggacagttaattgtcatttgtggtcggaacaaaacgctgagctcctcattgcaggctcttgaatggaaaataccaattaaggttaggggatttgagacccagatggagaaatggatgggggcttgtgattgcattataacaaaggctggaccaggtaccatcgccgaagccttgattagagggttgcctatcatccttaatgacttcatacctggacaggaagttggcaatgtcccttatgttgtggacaatggtgctggtgtcttctccaaaagttctagggaaactgctaaacttgttgcccgctggtttggtccagattctgatgaactgaagaggatgtcagaaaaagcgttaaaactggctcagccagaagcggtgtttgatattgtcagagacatccatgagctatctcgggagcaaggggtgatttcacagatatccagttccttgacatcatcctttttcataccatcgccagaaaccacacctatacaacttatgtga</cdnaseq>|
| |
| − | AA = <aaseq>LASPILNSLLSLSRRRRPPPQRGLVSLGGDGGVVVVVVVDGVAE GEVDPGDGAGDGGGVPPAAEDEAQVQEEPLLRGGAVAALASFYAKKVEAGLKKYKPDI IISVHPLMQHIPLWVLKWQGLQNRVVFVTVITDLNTCHPTWFHADVNRCYCPSEEVAK RAALDDLQPSQIRVFGLPIRPSFCRAVLVKDDLRKELELDPELPAVLLMGGGEGMGPV KKTAKALGESLFDKELGKPIGQLIVICGRNKTLSSSLQALEWKIPIKVRGFETQMEKW MGACDCIITKAGPGTIAEALIRGLPIILNDFIPGQEVGNVPYVVDNGAGVFSKSSRET AKLVARWFGPDSDELKRMSEKALKLAQPEAVFDIVRDIHELSREQGVISQISSSLTSS FFIPSPETTPIQLM</aaseq>|
| |
| − | DNA = <dnaseqindica>2..239#766..793#1770..1931#2033..2174#2591..2815#2920..2982#3088..3162#3469..3756#actcgcctccccaattttaaactcccttctctctctctctcgtcgtcgtcgtccaccgccgcaaaggggtctcgtctctctcgggggcgatggcggcgtcgtcgtcgtcgtcgtcgtcgatggcgtcgccgagggggaggtcgatccgggagacggtgctggagacggtggcggcgtaccaccagcagcagaggatgaggcgcaagttcaggaagagcctctcctacgcgggggagctgtcgtcggcggggcgcgcgcgaggggagggcggggcgtcctcgtcggcgtccaccacctcgctgtgtggccccgacgaggacgacgagcccttctgggaggaggaggagggcaccgtcgagctcgtccagctcggcgccaaccgggctaagaacgtgctcatcctcatgagcgacaccggcggcggccaccgcgcctccgccgaggctatcaaggacgccttccgcatcgagttcggcgacgattaccgggtgcgcggcctcctttttttttttttgctgctgtcgtctcgtgtgaaatcggcatggtagcgtaggctggaatctggccattgggaacacaagggttttgatttgttgtgctcgggattggcgttgtggcaggtcttcgtcaaggatctgtgcaaggatcacgcggggtggccgctgaacaacatggagagctcgtacaagttcatggtgaagcatgtgcagctatggaaggtggccttccacaccacatcgccgagatgggtccattgcttctacctcgccgcgctcgcctcattctatgccaagtacgccggatacttccctttcacggctcagcaatgtttttttaaaaaaaaaatcttactagaatgtttcattgtttcactgacagctttggcgatttgtgtttttcgtagttacgaattgttgttttttttttctgttgtttgctgcttccttggattgctaatcgctcatctaattgcagatttttgcaatggttcagcagttttgtcattatcgactaggcttataatttactctagagaagttttattagtgctagatattagcccgtgatgttacaggattagttttatattgccaattcttgagtgcaatcttcaactgtgaggttcttctttgacttgggatgctaaaatatctgttctgaatccatcgtaccacatagtgcgagtagtttgcttgaaatgcaaatctgaatatatggtaatattgagccgagatatgcaaccatgttggatctgttgaaccagagggttggagacaggaccagagagcatttcagaaaattcaattcctgccctgtgcatctacccaacatgcccacttggtcatcactcatatgctttcagaattgccagtctgtcctcgcataaaattgtttccaggtcatgatccacatattatgcatcataatagcacatgcaaactgttcatttgttggatcgctgtcagttctgtctaattccatgcttcagcaatctctgccaaccaattgacagtatagtcaatttaatatgtccgttcaagttttggatctattccgatgttgccattgattatatttgttgttagcgttctatgatcgaaattgcttcgagaaggcatcaaactaatgtaaaacagttcatttatagctctaacttgtggacccatgatcttaagctcatcgacccattatgtgtgtgagactttttctttacatcaagatggtacatggaacaccttttctgaatagcttattgtttgtgggtgaaggaaggttgaggctggactcaagaagtacaaaccagatattataattagtgtccaccccctcatgcaacacattcctctatgggtactcaaatggcaagggctacaaaatagagtggtctttgtcactgtcatcacagacctcaacacttgtcaccctacatggtacgtggaggctatccataagaaaaaacctggttatcttcttctgcaaaaacaattgtttctgttcaaaccattgaattaatcaatcggaaacattacaggttccatgctgatgtcaatagatgttactgcccatcggaagaagttgccaagagagcagcactggatgacctacaaccttctcaaatccgtgtgtttggccttccgattcggccatcattctgccgagccgttcttgttaaggtatgtgctccttatttaacttcaggactgttattccgatgcctgcgaattttttgtttcatatttgatctctcaaaaggtagatattcagtcgtggtattttacttgatctttcaataggtagatattcagtcgtggtattttatttgatcttgcagaatgtataggttatttatgcttttttatttaacatgcttaatgaatgctcttatcatggatttgtgctttgattaattgcaagcatgcataccccaaaagcattgctttaaatttaggatgtccattgactatattttaaaggaaaaatgacaaatttatgatagtgtggctgtacaatgatacacatcttaatacaaatgtgtagtatgcttttctatccactcaagtgttactttttttttaaaccaactcaccaggatgatttgaggaaggaacttgaattggatcctgagctgcctgcagtattgctgatgggaggtggagagggcatgggtcctgtcaagaagaccgcaaaagcccttggagagtcgttgtttgacaaggagcttggaaaaccaattggacagttaattgtcatttgtggtcggaacaaaacgctgagctcctcattgcaggctcttgaatggaaaataccaattaaggtatatgatagaaacgtgtgtttataataattctttttaagatgcagactgcttatcctcctatgttgaaacacatgttccttatcgacttcttttaacaaaaggttaggggatttgagacccagatggagaaatggatgggggcttgtgattgcattataacaaaggtatatccatgacattctatgattgttagcacgttatttcatacaaagatctctgtgtcattcttaaatcttaaatgttttttatgtttttatttgtctcaataggctggaccaggtaccatcgccgaagccttgattagagggttgcctatcatccttaatgacttcatacctggacaggttagggtctactaactttccgcggttattataaaagaacggtacgaatgtacatctatgttttatatggttattgactttgtggaccatacatatttaatactacaagggtgaatctcatgaaagttttatacgttaaataaaaaagatgtgtatgtgttttagaacttatttgtagcgtcagtgacactaatgttatgcagtgcacaaaataaatgattttttatcaagtgcgatatacagtatgtagcagttatatgatcacccagtggacatcatctaatgtaagtttgttctgcatggcaggaagttggcaatgtcccttatgttgtggacaatggtgctggtgtcttctccaaaagttctagggaaactgctaaacttgttgcccgctggtttggtccagattctgatgaactgaagaggatgtcagaaaaagcgttaaaactggctcagccagaagcggtgtttgatattgtcagagacatccatgagctatctcgggagcaaggggtgatttcacagatatccagttccttgacatcatcctttttcataccatcgccagaaaccacacctatacaacttatgtgaaaaatccgtgtatagctagaactgcattctttgacctcgtgaaatttgcctttgtcctacaatgtcctgaaaaagaaaaatatgtcaatggatttagctggtttgtttcatctgtctcacggcgttgggatgaggtaagcaggatttcgactgcttttcagtttgtggtctctcatggtagttatgggcttgtttgactgacagctgctcttgtgtaatatccatattcggtttttgttaaaatcattcgttcatatgattttttttaaaaaatcctgtcgtcctttgttcagagggaccagcgatgggctgcaaattgtacactgttagttgatgttggaaagtttaaacctctcgacttgtaacatatccattcatgtaagatccatcgtgactgtaaagtgtatgagacaatgacaaattgtgctagtgagagagtcatgtgcttgttgaagg</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054958.1 RefSeq:Os02g0802700]|
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]] | |
| − | [[Category:Japonica Chromosome 2]]
| |
| − | [[Category:Chromosome 2]]
| |
Please input one-sentence summary here.
Annotated Information
The gene osMGD is isolated from the submergence tolerant cultivar FR13A.
Function
OsMGD play an important role in coping various stresses for plants, which also provide us a possible approach to enhance plant multiple stresses tolerance.The enhanced expression of OsMGD may relate to photosynthesis, and play an important role during submergence.
The full length of OsMGD cDNA was amplified using 5'- and 3'-rapid amplification of cDNA ends, and found to consist of 1,671 bp with an
open reading frame of 1,077 bp (181-1257) encoding 358 amino acids.
The overexpression of OsMGD improves salt tolerance in tobacco and that galactolipids, MGDG and DGDG play an important role in the regulation of chloroplast structure and function in the plant salt stress response.
Expression
OsMGD encodes monogalactosyldiacylglycerol synthase (UDPgalactose: 1,2-diacylglycerol 3-β-D-galactosyl transferase; EC 2.4.1.46, MGDG synthase)
Time-course studies showed that the expression of OsMGD in the rice cultivars FR13A and IR42 (submergence-susceptive cultivar) during submergence was gradually increased and that expression in FR13A was higher than in IR42. The expression of OsMGD in FR13A was influenced by benzyladenine and illumination. The accumulation of OsMGD mRNA in both FR13A and IR42 was also increased by ethephon, gibberellin, drought and salt treatment, but cold stress had no effect on the expression of the gene. These results suggest that the expression of OsMGD mRNA requires benzyladenine or illumination, and that the process is also mediated by ethephon and gibberellin. Salt and drought stress have an effect similar to that of submergence. Furthermore, the enhanced expression of OsMGD may relate to photosynthesis, and play an important role during submergence.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Laboratory of Plant Biotechnology, Faculty of Agriculture, Tottori University, Koyama-cho, Minami 4-101,
Tottori 680-8553, Japan.
Plant Breeding Division, Bangladesh Institute of Nuclear Agriculture (BINA), Bangladesh Agricultural University Campus, Mymensingh-2202, Bangladesh.
State Key Laboratory of Soil Erosion and Dryland Farming on the Loess Plateau,Institute of Soil and Water Conservation, Northwest A&F University,
Faculty of Agriculture, Tottori University.
Laboratory of Plant Biotechnology, Faculty of Agriculture, Tottori University, Koyama, Tottori, 680-8553, Japan.
Institute of Biotechnology, Zhejiang University, Huajiachi Campus, Hangzhou, 310029, People’s Republic of China
References
Please input cited references here.
Cloning of a putative monogalactosyldiacylglycerol synthase gene from rice (Oryza sativa L.) plants and its expression in response to submergence and other stresses.Yanhua Qi, Yasuo Yamauchi, Jianqun Ling, Naoyoshi Kawano, Debao Li, Kiyoshi Tanaka Planta, 2004, 219(3): 450-458.
Maintenance of chloroplast structure and function by overexpression of the OsMGD gene leads to enhanced salt tolerance in tobacco. Shiwen Wang,Md. Imtiaz Uddin, Kiyoshi Tanaka, Lina Yin, Zhonghui Shi,Yanhua QiJun'ichi Mano,Kenji Matsui,Norihiro Shimomura,Takeshi Sakaki5,Xiping Deng1and Suiqi Zhang1.
Expression and subcellular localization of antiporter regulating protein OsARP in rice induced by submergence, salt and drought stresses. Md Imtiaz Uddin1, Maki Kihara1, Lina Yin, Mst Farida Perveen and Kiyoshi Tanaka.
Structured Information