Difference between revisions of "Os02g0202000"

From RiceWiki
Jump to: navigation, search
(References)
 
(One intermediate revision by one other user not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os02g0202000''''' was reported as '''''OsERF#003''''' in 2006 <ref name="ref1" /> by researchers from Japan.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os02g0202000''''' '''''<=>''''' '''''OsERF#003''''
  
The ethylene response factor (ERF) gene WIN1/SHN1 was shown to transcriptionally activate the expression of wax synthesis genes and wax production, resulting in drought tolerance in Arabidopsis. To further investigate the regulation of ERF proteins in rice, we started with homology search for rice genes in the National Center of Biological Informatics using the Arabidopsis WIN1/SHN1 as a probe and found 4 rice orthologues with high amino acid identities in N-terminal region. These rice WIN1-like genes, named rice wax synthesis regulator (OsWR), all encode ERF proteins that contain a basic N-terminal region that might function as an nuclear localization signal and an acidic C-terminal region that might act as an activation domain for transcription. OsWR1 (Os02g0202000) is one of them.
 
 
===Function===
 
===Function===
 
+
* Genes in the ERF family encode transcriptional regulators with a variety of functions involved in the developmental and physiological processes in plants.
Transcript analysis showed that OsWR1 is induced by drought, abscisic acid and salt, and is predominantly expressed in leaves. Functional analyses indicated that over expressing OsWR1 improved while RNA interference OsWR1 rice decreased drought tolerance, consistent with water loss and cuticular permeability, suggesting that OsWR1-triggered drought response might be associated with cuticular characteristics. In addition, OsWR1 activated the expression of the genes-related to oxidative stress response and membrane stability. Gas chromatograph–mass spectrometry analysis further showed that OsWR1 modulated the wax synthesis through alteration of long chain fatty acids and alkanes, evidencing the regulation of OsWR1 in wax synthesis. This WIN1-like OsWR1 controls wax formation by direct or collaborative activation of wax synthesis genes, and this regulation, distinct from its homology regulator of WIN1/SHN1 in cutin synthesis, subsequently results in reduced water loss and enhanced drought tolerance.
+
* It has been demonstrated that the AP2/ERF proteins have important functions in the transcriptional regulation of a variety of biological processes related to growth and development, as well as various responses to environmental stimuli.
 
+
* Genes in the AP2 family have been shown to participate in the regulation of developmental processes, e.g. flower development (Elliott et al., 1996), spikelet meristem determinacy (Chuck et al., 1998), leaf epidermal cell identity (Moose and Sisco, 1996), and embryo development (Boutilier et al., 2002).<ref name="ref2" />
===Expression===
 
 
 
OsWR1 (Os02g0202000), encodes a protein of 205 amino acids with a predicted protein molecular weight of 22.45 kDa.As the expression patterns of the gene in different tissues might be associated with its function, we further investigated the expression of OsWR1 in different tissues of rice with Q-PCR. Our data showed that transcripts of OsWR1 were highly expressed in seedling leaves and stems, compared to these in seedling roots, whereas the expression of OsWR1 was mainly detected in leaves, blade sheaths, eustipes, internodes, testae and thrumb in the heading stage, indicating that the targets of OsWR1 might be expressed, at least partly, in the same tissues as the transcription factor.
 
  
 
===Evolution===
 
===Evolution===
 +
* The ERF family is a large gene family of transcription factors and is part of the AP2/ERF superfamily, which also contains the AP2 and RAV families
 +
* The AP2/ERF superfamily is defined by the AP2/ERF domain, which consists of about 60 to 70 amino acids and is involved in DNA binding.
 +
* The AP2 family proteins contain two repeated AP2/ERF domains, the ERF family proteins contain a single AP2/ERF domain, and the RAV family proteins contain a B3 domain, which is a DNA-binding domain conserved in other plant-specific transcription factors, including VP1/ABI3, in addition to the single AP2/ERF domain.
 +
* The expansion of the ERF family in plants might have been due to chromosomal/segmental duplication and tandem duplication, as well as more ancient transposition and homing.
 +
* Since rice is a cultivated species, selection either during domestication from its wild ancestor or during agricultural improvement in the subsequent time may also have been important for the evolution of rice ERF family.<ref name="ref3" />
  
[[File:Fig-1.jpg|right|thumb|150px|''Sequence analysis of OsWR1 with WIN1-like.A: Whole amino acid sequence comparison of WIN1-like from Arabidopsis and rice. Asterisks represent the putative domain of the nuclear localization signal, the black line indicates the highly conserved AP2 domain, and double black lines indicate the putative activation domain. The shaded boxes indicate the percentage of sequences at this position with the same amino acid identity: black, 100%; and gray, 75%. Protein names are indicated at the left. B: Nucleotide sequences comparison derived from sequence alignment of ERF whole regions from Arabidopsis and rice'']]
+
You can also add sub-section(s) at will.
The amino acid of full length OsWR1 shows a high similarity to WIN1/SHN1 (68.8%), SHN2 (58%), SHN3 (57.8%) and OsWR2 (Os06g0604000, 81%), but low similarity to OsWR3 (Os02g0797100, 41.4%) and OsWR4 (Os06g0181700, 41.7%); these all contain the conserved ERF domain (Fig. 1a), suggesting that OsWR1 is ahomology of WIN1/SHN1.
 
The WIN1-like members are conserved in gene structure because five of them (three from Arabidopsis and two from rice) contain a single intron positioned at 80–83 bp from the start codon, located from 80 bp in WIN/SHN genes, but from 83 bp in rice WIN1-like genes.The three odd nucleotides code the basic amino acid lysine (Fig. 1b). We reasoned that such sequence conservation with WIN/SHN genes, which were shown to participate in wax and cutin syntheses, might confer a similar function in rice.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
 +
* Molecular and Cellular Breeding Research Group, Institute for Biological Resources and Functions, National Institute of Advanced Industrial Science and Technology, Tsukuba, Ibaraki 305–8566, Japan (T.N., K.S., H.S.);
 +
* Graduate School of Life and Environmental Sciences, University of Tsukuba, Tsukuba, Ibaraki 305–8672, Japan (T.N., T.F.)
  
Biotechnology Research Institute, Chinese Academy of Agricultural Sciences
 
  
 
==References==
 
==References==
 +
<references>
 +
* <ref name="ref1">
 +
Nakano T, Suzuki K, Fujimura T, Shinshi H. Genome-wide analysis of the ERF
 +
gene family in Arabidopsis and rice. Plant Physiol. 2006 Feb;140(2):411-32.
 +
PubMed PMID: 16407444; PubMed Central PMCID: PMC1361313.
 +
</ref>
 +
* <ref name="ref2">
 +
Chuck G, Muszynski M, Kellogg E, Hake S, Schmidt RJ. The control of spikelet
 +
meristem identity by the branched silkless1 gene in maize. Science. 2002 Nov
 +
8;298(5596):1238-41. PubMed PMID: 12424380.
 +
</ref>
 +
* <ref name="ref3">
 +
Riechmann JL, Meyerowitz EM. The AP2/EREBP family of plant transcription
 +
factors. Biol Chem. 1998 Jun;379(6):633-46. Review. PubMed PMID: 9687012.
 +
</ref>
 +
</references>
  
Wang, Y., et al. (2012). "An ethylene response factor OsWR1 responsive to drought stress transcriptionally activates wax synthesis related genes and increases wax production in rice." Plant Mol Biol 78(3): 275-288.
 
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]
GeneName = Os02g0202000|
 
Description = Pathogenesis-related transcriptional factor and ERF domain containing protein|
 
Version = NM_001052761.2 GI:297598782 GeneID:4328653|
 
Length = 1051 bp|
 
Definition = Oryza sativa Japonica Group Os02g0202000, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
 
AP = Chromosome 2:5688756..5689806|
 
CDS = 5688851..5688933,5689055..5689589|
 
GCID = <gbrowseImage1>
 
name=NC_008395:5688756..5689806
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008395:5688756..5689806
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggtacagccaaagaagaagtttcgtggagtcaggcagcggcactggggctcctgggtctctgagatcagacaccccctccttaaaaggagggtgtggctgggcacctttgagacggccgaggaggctgcgcgagcctacgatgaggctgctgtgctgatgagtggccgcaacgccaagaccaacttccccgtgcagaggaactccaccggtgatctcgccacggccgcagaccaggacgcccgtagcaatggcggtagcaggaactcctccgcgggcaacctgtcacagattctcagtgctaagctccgcaagtgctgcaaggcgccatctccgtccttaacctgcctccgcctcgaccccgagaagtcccacattggcgtgtggcaaaagcgcgcaggggcccgtgctgactccaactgggtgatgacggtggagctcaacaaagaggtagaaccaactgaacctgcagctcagcccacatcaacagcaacagcttcgcaagtgacaatggatgatgaggaaaagattgcgctgcaaatgatcgaggagttgctgagcaggagcagtccagcttcaccctcacatggagagggagagggtagctttgtcatctga</cdnaseq>|
 
AA = <aaseq>MVQPKKKFRGVRQRHWGSWVSEIRHPLLKRRVWLGTFETAEEAA                    RAYDEAAVLMSGRNAKTNFPVQRNSTGDLATAADQDARSNGGSRNSSAGNLSQILSAK                    LRKCCKAPSPSLTCLRLDPEKSHIGVWQKRAGARADSNWVMTVELNKEVEPTEPAAQP                    TSTATASQVTMDDEEKIALQMIEELLSRSSPASPSHGEGEGSFVI</aaseq>|
 
DNA = <dnaseqindica>96..178#300..834#gttcagttcagaggcgcctagcaatagcagctcattgcctcatctctgcctcccctgtccttctgggggcagagaatctctccactgctggaaaaatggtacagccaaagaagaagtttcgtggagtcaggcagcggcactggggctcctgggtctctgagatcagacaccccctcctgtaagctcttctatcaacatccctctaattttctgctaataatgttatgttttgatgtgtctaatactctaatctaataagtaataagtctcaatgcatatggtgtttgcaactaatgcagtaaaaggagggtgtggctgggcacctttgagacggccgaggaggctgcgcgagcctacgatgaggctgctgtgctgatgagtggccgcaacgccaagaccaacttccccgtgcagaggaactccaccggtgatctcgccacggccgcagaccaggacgcccgtagcaatggcggtagcaggaactcctccgcgggcaacctgtcacagattctcagtgctaagctccgcaagtgctgcaaggcgccatctccgtccttaacctgcctccgcctcgaccccgagaagtcccacattggcgtgtggcaaaagcgcgcaggggcccgtgctgactccaactgggtgatgacggtggagctcaacaaagaggtagaaccaactgaacctgcagctcagcccacatcaacagcaacagcttcgcaagtgacaatggatgatgaggaaaagattgcgctgcaaatgatcgaggagttgctgagcaggagcagtccagcttcaccctcacatggagagggagagggtagctttgtcatctgaaaggcttggatgaaacgacggcataacgaagtcaccactctagaccatggttccagaatttcctgctggtacacaggcagttcagattacttcagtacaatagaaaatatctattacttcagacaagtaacaagacatataagtttgcaactatgtgtagctatatgtgtttatgaaaagctatatatacgcagtctccatcaacatactttgttac</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001052761.2 RefSeq:Os02g0202000]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 2]]
 
[[Category:Chromosome 2]]
 

Latest revision as of 08:04, 23 March 2017

The rice Os02g0202000 was reported as OsERF#003 in 2006 [1] by researchers from Japan.

Annotated Information

Gene Symbol

  • Os02g0202000 <=> OsERF#003'

Function

  • Genes in the ERF family encode transcriptional regulators with a variety of functions involved in the developmental and physiological processes in plants.
  • It has been demonstrated that the AP2/ERF proteins have important functions in the transcriptional regulation of a variety of biological processes related to growth and development, as well as various responses to environmental stimuli.
  • Genes in the AP2 family have been shown to participate in the regulation of developmental processes, e.g. flower development (Elliott et al., 1996), spikelet meristem determinacy (Chuck et al., 1998), leaf epidermal cell identity (Moose and Sisco, 1996), and embryo development (Boutilier et al., 2002).[2]

Evolution

  • The ERF family is a large gene family of transcription factors and is part of the AP2/ERF superfamily, which also contains the AP2 and RAV families
  • The AP2/ERF superfamily is defined by the AP2/ERF domain, which consists of about 60 to 70 amino acids and is involved in DNA binding.
  • The AP2 family proteins contain two repeated AP2/ERF domains, the ERF family proteins contain a single AP2/ERF domain, and the RAV family proteins contain a B3 domain, which is a DNA-binding domain conserved in other plant-specific transcription factors, including VP1/ABI3, in addition to the single AP2/ERF domain.
  • The expansion of the ERF family in plants might have been due to chromosomal/segmental duplication and tandem duplication, as well as more ancient transposition and homing.
  • Since rice is a cultivated species, selection either during domestication from its wild ancestor or during agricultural improvement in the subsequent time may also have been important for the evolution of rice ERF family.[3]

You can also add sub-section(s) at will.

Labs working on this gene

  • Molecular and Cellular Breeding Research Group, Institute for Biological Resources and Functions, National Institute of Advanced Industrial Science and Technology, Tsukuba, Ibaraki 305–8566, Japan (T.N., K.S., H.S.);
  • Graduate School of Life and Environmental Sciences, University of Tsukuba, Tsukuba, Ibaraki 305–8672, Japan (T.N., T.F.)


References

  1. Nakano T, Suzuki K, Fujimura T, Shinshi H. Genome-wide analysis of the ERF gene family in Arabidopsis and rice. Plant Physiol. 2006 Feb;140(2):411-32. PubMed PMID: 16407444; PubMed Central PMCID: PMC1361313.
  2. Chuck G, Muszynski M, Kellogg E, Hake S, Schmidt RJ. The control of spikelet meristem identity by the branched silkless1 gene in maize. Science. 2002 Nov 8;298(5596):1238-41. PubMed PMID: 12424380.
  3. Riechmann JL, Meyerowitz EM. The AP2/EREBP family of plant transcription factors. Biol Chem. 1998 Jun;379(6):633-46. Review. PubMed PMID: 9687012.


Structured Information