Difference between revisions of "Os07g0492000"

From RiceWiki
Jump to: navigation, search
(References)
 
(3 intermediate revisions by 3 users not shown)
Line 1: Line 1:
Nucleoside diphosphate kinase (NDK) is a ubiquitous enzyme found in all organisms and cell types, and catalyzes the transfer of the phosphoryl group from a nucleoside triphosphate to a nucleoside diphosphate.  
+
The rice '''''Os07g0492000''''' was reported as '''''NDK1''''' in (2005) <ref name="ref1" /> by researchers from China.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os04g0620000''''' '''<=>''' '''''NDK, NDK-1, NDK1, NDKR, OsNDPK1, rNDK'''''
 +
 
===Function===
 
===Function===
1. Crystal structure of nucleoside diphosphate kinase required for coleoptile elongation in rice
+
* Nucleoside diphosphate kinase (NDK) is a ubiquitous enzyme found in all organisms and cell types, and catalyzes the transfer of the phosphoryl group from a nucleoside triphosphate to a nucleoside diphosphate.  <ref name="ref1" /><ref name="ref2" />
2. OsNDPK1 expression in rice plants is enhanced upon infection with bacterial pathogens
+
* The enzyme is involved in and required for coleoptile elongation in rice as the level of the rice NDK (rNDK) changes during seed germination and the early stages of seedling growth.
  
 
===Expression===
 
===Expression===
Transcripts of OsNDPK1 accumulated strongly after infection with Xoo. When rice plants were infected with Burkholderia glumae, a bacterial grain/seedling rot pathogen, the pattern of expression of the rice NDPK genes was similar to that following infection with Xoo. OsNDPK1 gene expression was also strongly induced in response to exposure to salicylic acid, jasmonic acid, and abscisic acid, although the level of transcripts and their pattern of expression depended on the inducer.
+
* The expression of rice NDK gene is up-regulated in the growing coleoptiles when the anaerobic stress persists.
[[File:Differential induction of the rice NDPK genes following treatment.jpg|right|thumb|150px|"Differential induction of the rice NDPK genes  (from reference  <ref name="ref2" />)."]]
 
  
 
===Evolution===
 
===Evolution===
When OsNDPK1 was aligned with other rice NDPK isoforms, it proved to be moderately similar to the conserved regions of NP922751 (76% identity), OsNDPK2 (67% identity), and OsNDPK3 (55% identity).
+
* When OsNDPK1 was aligned with other rice NDPK isoforms, it proved to be moderately similar to the conserved regions of NP922751 (76% identity), OsNDPK2 (67% identity), and OsNDPK3 (55% identity).
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Agricultural Plant Stress Research Center, Applied Plant Science Division, College of Agriculture and Life Sciences, Chonnam
+
* Biology Group, Research Division, National Synchrotron Radiation Research Center, Hsinchu 30076, Taiwan
National University, Gwangju 500-757, Korea;
+
* Department of Life Sciences and Structural Biology Program, National Tsing-Hua University, Hsinchu 30076, Taiwan
 +
* Department of Physics, National Tsing-Hua University, Hsinchu 30076, Taiwan
 +
* Institute of Biological Chemistry, Academia Sinica, Taipei 11529, Taiwan
  
 
==References==
 
==References==
Line 23: Line 27:
 
<ref name="ref1">Huang J Y, Chang T, Chang C Y, et al. Crystal structure of nucleoside diphosphate kinase required for coleoptile elongation in rice (< i> Oryza sativa</i> L.)[J]. Journal of structural biology, 2005, 150(3): 309-318.</ref>
 
<ref name="ref1">Huang J Y, Chang T, Chang C Y, et al. Crystal structure of nucleoside diphosphate kinase required for coleoptile elongation in rice (< i> Oryza sativa</i> L.)[J]. Journal of structural biology, 2005, 150(3): 309-318.</ref>
 
<ref name="ref2"> Cho S M, Shin S H, Kim K S, et al. Enhanced expression of a gene encoding a nucleoside diphosphate kinase 1 (OsNDPK1) in rice plants upon infection with bacterial pathogens[J]. Mol Cells, 2004, 18(3): 390-395.</ref>
 
<ref name="ref2"> Cho S M, Shin S H, Kim K S, et al. Enhanced expression of a gene encoding a nucleoside diphosphate kinase 1 (OsNDPK1) in rice plants upon infection with bacterial pathogens[J]. Mol Cells, 2004, 18(3): 390-395.</ref>
 
+
</references>
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os07g0492000|
 
Description = Nucleoside diphosphate kinase I (EC 2.7.4.6) (NDK I) (NDP kinase I) (NDPK I)|
 
Version = NM_001066217.1 GI:115472166 GeneID:4343275|
 
Length = 2484 bp|
 
Definition = Oryza sativa Japonica Group Os07g0492000, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 7|Chromosome 7]]|
 
AP = Chromosome 7:18995155..18997638|
 
CDS = 18995452..18995569,18996011..18996242,18997223..18997271,18997470..18997520|
 
GCID = <gbrowseImage1>
 
name=NC_008400:18995155..18997638
 
source=RiceChromosome07
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008400:18995155..18997638
 
source=RiceChromosome07
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggagcagtccttcatcatgatcaagcctgacggcgtccagagaggcctgattggagacatcatcagcaggttcgagaagaaaggattctacctgagggggatgaagttcatgaatgtggagaggtcctttgcacagcagcactatgccgacctttccgacaagcccttcttccctgggttggtggagtacatcatctctggccccgtcgttgcgatggtttgggaagggaaggatgttgttgccactggccgcaggatcattggggccaccaggccctgggaggcagcccccggcaccatccgtgctgactatgccgtggaagttggcaggaatgtcatccatgggagcgactccgtggacaacgggaagaaggagatcgctctctggttccctgaaggtttagctgagtggaggagcaaccttcacccttggatctatgagtcttag</cdnaseq>|
 
AA = <aaseq>MEQSFIMIKPDGVQRGLIGDIISRFEKKGFYLRGMKFMNVERSF                    AQQHYADLSDKPFFPGLVEYIISGPVVAMVWEGKDVVATGRRIIGATRPWEAAPGTIR                    ADYAVEVGRNVIHGSDSVDNGKKEIALWFPEGLAEWRSNLHPWIYES</aaseq>|
 
DNA = <dnaseqindica>2070..2187#1397..1628#368..416#119..169#actccgcctcgcctccactcctctcctctccgcatcctcctcatcgcctccgcttctgcttttttttttcttttttctcgttgatcggtttgttcgatcagatcggttctttggagagatggagcagtccttcatcatgatcaagcctgacggcgtccagagaggcctggtaatctgacttctttttttcttttaatgttcttcttgtcgttttggccatcgattttcgagaggaattttgcggtttcggatcggttaaatagcgtagttgattggtgtttgtttgtgagattttgagttgttttggtaactttttgtaccgttttgcgtggtttttaatggggaattttgattttctgttctgcagattggagacatcatcagcaggttcgagaagaaaggattctacctgaggggtatggctgatccttttcccctctcgatttgatcgtatggattcatttttcataactttcttttgtatttttattgatctaattttgggttgacctacccgtttttttcaacacatattatgaaaagcagaggctgacgatatcataatactctgtttcatatgggtaggttggggttgtgagttgtgacatggagaatttgatgggtttaatacatgattcaaaagcaagatttttttatataatttatatgttgatgattggccatttttaactggggacaacagactgacacagtaatattcaatttagtatatcaactgattcgttgtcaagtctaattttgcattacatgacatgggcaacttatttattattatagcagagatcgtcaaagcctcaaagatgtagtctactatttgtacttgtaatcatggaaatatctttctgaaaagaaaacatcatttgtacttgcaatagagttcaactaatatctttggcatgcatttaacgtgctcttttccattttttgttccttattaaaagttgttgtactttagtggaaaccaaaatgttttataaagcattacagaacaacaaaaacagctgtcttaaggaacagcaacaaagaacagaagtaaaggactttcatttaacttcccctgtttataacaactgtgtagccatgtattggttgatgtggcgattataacaactgtgaagcccatttttatgagaattattcgaaatgcacgcaaaacatcatccaaaaacttaatttcatttaacttcccctgtttaagaaatatacttcctccattccaaactataagcatttatgcgtgttattcacaatgaatctcgatcttgagattcattctgaaaaacaagtataaatgctttttattttggaacggaggtaatattcggttgagggatgatggtgcttacgaattactttttgaactgcaatgatccagggatgaagttcatgaatgtggagaggtcctttgcacagcagcactatgccgacctttccgacaagcccttcttccctgggttggtggagtacatcatctctggccccgtcgttgcgatggtttgggaagggaaggatgttgttgccactggccgcaggatcattggggccaccaggccctgggaggcagcccccggcaccatccgtgctgactatgccgtggaagttggcaggtgagtcattcttgtctgtcttggtcatcagctcattattgcttgaattttcagtcagttcttgtgatccttttaatcatgtaaggatcctgagcgatggatggttctttatttgttttgctgctagcatcaaacgatgattttgtttgaaaatgggtggttaagtggcttttattttgatctatataaatgtgtgaacctctgttttttaccagtcagaaggtatcagatagtgaatgtgctgtgatatgatttacaaaaacttttgcatgcattatgatgttcatcttttctatatgttacgatgttagtgtatttagacataataactacttggattatgttaaactatgttcaattctagcttttgtttttgaaaataaaaatcataatgcttcctgcttatcgatgcctaagctcaagctgttgtttcttgtgtaggaatgtcatccatgggagcgactccgtggacaacgggaagaaggagatcgctctctggttccctgaaggtttagctgagtggaggagcaaccttcacccttggatctatgagtcttagagcttcgcgcctataatcgatcacctcttggtggctagttctcgttaaatatttgagttttgtttcagagttgtcatctggctgcctcctgagtcaccattataattctgctgtgatacaatcacagttatatgttgcctgaacttatatggctttttaagtttctggattggatgtgatgggaaaataatactagcagtcagtttttgcttataaatgtcgtaatatcttaatcatgctctttccctaggttcatccaagataagcagatggtgttgcctgattttcttgtggcac</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001066217.1 RefSeq:Os07g0492000]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 14:59, 6 May 2017

The rice Os07g0492000 was reported as NDK1 in (2005) [1] by researchers from China.

Annotated Information

Gene Symbol

  • Os04g0620000 <=> NDK, NDK-1, NDK1, NDKR, OsNDPK1, rNDK

Function

  • Nucleoside diphosphate kinase (NDK) is a ubiquitous enzyme found in all organisms and cell types, and catalyzes the transfer of the phosphoryl group from a nucleoside triphosphate to a nucleoside diphosphate. [1][2]
  • The enzyme is involved in and required for coleoptile elongation in rice as the level of the rice NDK (rNDK) changes during seed germination and the early stages of seedling growth.

Expression

  • The expression of rice NDK gene is up-regulated in the growing coleoptiles when the anaerobic stress persists.

Evolution

  • When OsNDPK1 was aligned with other rice NDPK isoforms, it proved to be moderately similar to the conserved regions of NP922751 (76% identity), OsNDPK2 (67% identity), and OsNDPK3 (55% identity).

You can also add sub-section(s) at will.

Labs working on this gene

  • Biology Group, Research Division, National Synchrotron Radiation Research Center, Hsinchu 30076, Taiwan
  • Department of Life Sciences and Structural Biology Program, National Tsing-Hua University, Hsinchu 30076, Taiwan
  • Department of Physics, National Tsing-Hua University, Hsinchu 30076, Taiwan
  • Institute of Biological Chemistry, Academia Sinica, Taipei 11529, Taiwan

References

  1. 1.0 1.1 Huang J Y, Chang T, Chang C Y, et al. Crystal structure of nucleoside diphosphate kinase required for coleoptile elongation in rice (< i> Oryza sativa</i> L.)[J]. Journal of structural biology, 2005, 150(3): 309-318.
  2. Cho S M, Shin S H, Kim K S, et al. Enhanced expression of a gene encoding a nucleoside diphosphate kinase 1 (OsNDPK1) in rice plants upon infection with bacterial pathogens[J]. Mol Cells, 2004, 18(3): 390-395.

Structured Information