|
|
| (2 intermediate revisions by one other user not shown) |
| Line 4: |
Line 4: |
| | ===Function=== | | ===Function=== |
| | Please input function information here. | | Please input function information here. |
| − |
| |
| | | | |
| | ===Expression=== | | ===Expression=== |
| Line 13: |
Line 12: |
| | | | |
| | You can also add sub-section(s) at will. | | You can also add sub-section(s) at will. |
| − | ATP synthase F0 subunit 8
| |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| Line 22: |
Line 20: |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{Mitochondrion|
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Mitochondrion]] |
| − | GeneName = atp8|
| |
| − | Description = Subunit 8 of the F0 sector of mitochondrial inner membrane F1-F0 ATP synthase, encoded on the mitochondrial genome|
| |
| − | Version = GeneID:807862|
| |
| − | Length = 207 bp|
| |
| − | Definition = Oryza sativa Japonica Group ''atp8'', Mitochondrion gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Mitochondrion|Mitochondrion]]|
| |
| − | AP = Mitochondrion:7784..7990|
| |
| − | CDS = 7784..7990|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_011033:7784..7990
| |
| − | source=Rice_Japonica_Mitochondrion
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_011033:263141..263365
| |
| − | source=Rice_Japonica_Mitochondrion
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | AA = <aaseq>MPQLDTSKWFITILSVMFTLFVLFQVKLSNYNFPLDLSSKSEDLKKNKTPWELKWTKIYLPHLLPLQ</aaseq>|
| |
| − | DNA = <dnaseqindica>1..225#ATGCCCCAACTAAATACCGCCGTATGACCCACCATAATTACCCCCATACTCCTGACACTATTTCTCGTCA
| |
| − | CCCAACTAAAAATATTAAATTCAAATTACCATCTACCCCCCTCACCAAAACCCATAAAAATAAAAAACTA
| |
| − | CAATAAACCCTGAGAACCAAAATGAACGAAAATCTATTCGCTTCATTCGCTGCCCCCACAATCCTAG</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/gene/807862 NCBI Gene:atp8]
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]] | |
| − | [[Category:Japonica Mitochondrion]]
| |
| − | [[Category:Mitochondrion]]
| |
Please input one-sentence summary here.
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information