Difference between revisions of "Os02g0725700"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os02g0725700| Description = Histone-like transcription factor/archaeal histone/DNA topoisomerase family protein| Version = NM_001054521.2 GI:2975...")
 
 
(2 intermediate revisions by 2 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''''Os02g0725700''''' was reported as '''''OsHAP3E''''' in 2011 <ref name="ref1" /> by researchers from Japan.  
GeneName = Os02g0725700|
 
Description = Histone-like transcription factor/archaeal histone/DNA topoisomerase family protein|
 
Version = NM_001054521.2 GI:297599866 GeneID:4330586|
 
Length = 1078 bp|
 
Definition = Oryza sativa Japonica Group Os02g0725700, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
+
==Annotated Information==
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
===Gene Symbol===
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
*'''''Os02g0725700''''' '''<=>''' '''''OsHAP3E, OsLEC1/OsHAP3E, OsLEC1'''''
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
 
|
+
===Function===
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
+
* '''''OsHAP3E''''' plays important pleiotropic roles in vegetative and reproductive development or basic cellular processes in rice.
AP = Chromosome 2:31051161..31052238|
+
* The rice '''''OsHAP3E''''' which encodes a subunit of a CCAAT-motif binding HAP complex.
CDS = 31051473..31052237|
+
* There is an association of '''''OsHAP3E''''' with determination of floral meristem identity.
GCID = <gbrowseImage1>
+
* The '''''OsHAP3E''''' function is essential for rice cells.
name=NC_008395:31051161..31052238
+
===Expression===
source=RiceChromosome02
+
* The '''''OsHAP3E-overexpressing''''' plants showed various abnormal morphologies both in their vegetative and reproductive phases. ''
preset=GeneLocation
+
* The '''''OsHAP3E-overexpressing''''' plants were dwarf with erected leaves and similar to brassinosteroid mutants in the vegetative phase.  
</gbrowseImage1>|
+
* In the reproductive phase, dense panicle was developed, and occasionally successive generation of lateral rachises and formation of double flowers were observed.
GSID = <gbrowseImage2>
+
* On the other hand, repression of '''''OsHAP3E''''' by RNAi or by overexpressing chimeric repressor fusion constructs brought about lethality to transformed cells, and almost no transformant was obtained.  
name=NC_008395:31051161..31052238
+
 
source=RiceChromosome02
+
You can also add sub-section(s) at will.
preset=GeneLocation
+
 
</gbrowseImage2>|
+
==Labs working on this gene==
CDNA = <cdnaseq>atggaggccggctacccgggcacggcggcgaacggcgctgccgccgacgggaacggtggcgcgcagcaggcggcggccgcgccggctatacgtgagcaggaccggctgatgccgatcgcgaacgtgatccgcatcatgcgccgcgtgctcccggcgcacgccaagatctcggacgacgccaaggagacgatccaggagtgcgtgtcggagtacatcagcttcatcaccggggaggccaacgagcggtgccagcgcgagcagcgcaagaccatcaccgccgaggacgtgctctgggccatgagccgcctcggcttcgacgactacgtcgagcccctcggcgtctacctccaccgctaccgcgagttcgagggggagtcccgcggcgtcggcgtcggcgtcggcgccgcgcgcggcgaccaccaccatggtcacgtcggtgggatgctcaagtcccgcgcgcagggctccatggtgacgcaccacgacatgcagatgcacgccgccatgtacggtggcggcgcggtgccgccgccgccgcatcctcctccgcaccaccacgcgttccaccagctcatgccgccgcaccacggccagtacgcgccgccgtacgacatgtacggcggcgagcacgggatggcggcgtactacggcgggatgtacgcgcccggcagcggcggcgacgggagcggcagcagcggcagcggtggcgccggcacgccgcagaccgtcaacttcgagcaccagcatccgttcggatacaagtag</cdnaseq>|
+
* Graduate School of Agricultural Science, Tohoku University, 1-1 Tsutsumidori-Amamiyamachi, Aoba-ku, Sendai 981-8555, Japan
AA = <aaseq>MEAGYPGTAANGAAADGNGGAQQAAAAPAIREQDRLMPIANVIR                    IMRRVLPAHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSR                    LGFDDYVEPLGVYLHRYREFEGESRGVGVGVGAARGDHHHGHVGGMLKSRAQGSMVTH                    HDMQMHAAMYGGGAVPPPPHPPPHHHAFHQLMPPHHGQYAPPYDMYGGEHGMAAYYGG                    MYAPGSGGDGSGSSGSGGAGTPQTVNFEHQHPFGYK</aaseq>|
+
* Plant Genetics Laboratory, National Institute of Genetics, 1111 Yata, Mishima, Shizuoka 411-8540, Japan
DNA = <dnaseqindica>2..766#aatggaggccggctacccgggcacggcggcgaacggcgctgccgccgacgggaacggtggcgcgcagcaggcggcggccgcgccggctatacgtgagcaggaccggctgatgccgatcgcgaacgtgatccgcatcatgcgccgcgtgctcccggcgcacgccaagatctcggacgacgccaaggagacgatccaggagtgcgtgtcggagtacatcagcttcatcaccggggaggccaacgagcggtgccagcgcgagcagcgcaagaccatcaccgccgaggacgtgctctgggccatgagccgcctcggcttcgacgactacgtcgagcccctcggcgtctacctccaccgctaccgcgagttcgagggggagtcccgcggcgtcggcgtcggcgtcggcgccgcgcgcggcgaccaccaccatggtcacgtcggtgggatgctcaagtcccgcgcgcagggctccatggtgacgcaccacgacatgcagatgcacgccgccatgtacggtggcggcgcggtgccgccgccgccgcatcctcctccgcaccaccacgcgttccaccagctcatgccgccgcaccacggccagtacgcgccgccgtacgacatgtacggcggcgagcacgggatggcggcgtactacggcgggatgtacgcgcccggcagcggcggcgacgggagcggcagcagcggcagcggtggcgccggcacgccgcagaccgtcaacttcgagcaccagcatccgttcggatacaagtagtaacagcagcagaatggcgatcggtctgcacctgcatgcacacgtatcgcatgcagatcgagctagtagtgcaactggctaacttgaaccagttaaaaacttaagacttagtgatcgtgtgtggtttaattaatttgctacgttcaggtagtgatcgatgagattttaatttcctactgtcagtttaattcaccgttcatgtactcgatccagctagtactactcctagttacccttgttctaatcttaacgcaattgtgtcgatcggacgatcgcacgtttatcttcaagtggaatttgtcttataacact</dnaseqindica>|
+
* Department of Life Science, Graduate University for Advanced Studies, 1111 Yata, Mishima, Shizuoka 411-8540, Japan
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054521.2 RefSeq:Os02g0725700]|
+
* Bioproduction Research Institute, National Institute of Advanced Industrial Science and Technology (AIST), Central 4, Higashi 1-1-1, Tsukuba, Ibaraki 305-8562, Japan
}}
+
==References==
[[Category:Genes]]
+
<references>
[[Category:Japonica mRNA]]
+
* <ref name="ref1">
[[Category:Oryza Sativa Japonica Group]]
+
Ito Y, Thirumurugan T, Serizawa A, Hiratsu K, Ohme-Takagi M, Kurata N.
[[Category:Japonica Genes]]
+
Aberrant vegetative and reproductive development by overexpression and lethality
[[Category:Japonica Chromosome 2]]
+
by silencing of OsHAP3E in rice. Plant Sci. 2011 Aug;181(2):105-10. doi:
[[Category:Chromosome 2]]
+
10.1016/j.plantsci.2011.04.009. PubMed PMID: 21683874.
 +
</ref>
 +
 
 +
</references>
 +
 
 +
==Structured Information==
 +
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]

Latest revision as of 02:02, 24 February 2017

The rice Os02g0725700 was reported as OsHAP3E in 2011 [1] by researchers from Japan.

Annotated Information

Gene Symbol

  • Os02g0725700 <=> OsHAP3E, OsLEC1/OsHAP3E, OsLEC1

Function

  • OsHAP3E plays important pleiotropic roles in vegetative and reproductive development or basic cellular processes in rice.
  • The rice OsHAP3E which encodes a subunit of a CCAAT-motif binding HAP complex.
  • There is an association of OsHAP3E with determination of floral meristem identity.
  • The OsHAP3E function is essential for rice cells.

Expression

  • The OsHAP3E-overexpressing plants showed various abnormal morphologies both in their vegetative and reproductive phases.
  • The OsHAP3E-overexpressing plants were dwarf with erected leaves and similar to brassinosteroid mutants in the vegetative phase.
  • In the reproductive phase, dense panicle was developed, and occasionally successive generation of lateral rachises and formation of double flowers were observed.
  • On the other hand, repression of OsHAP3E by RNAi or by overexpressing chimeric repressor fusion constructs brought about lethality to transformed cells, and almost no transformant was obtained.

You can also add sub-section(s) at will.

Labs working on this gene

  • Graduate School of Agricultural Science, Tohoku University, 1-1 Tsutsumidori-Amamiyamachi, Aoba-ku, Sendai 981-8555, Japan
  • Plant Genetics Laboratory, National Institute of Genetics, 1111 Yata, Mishima, Shizuoka 411-8540, Japan
  • Department of Life Science, Graduate University for Advanced Studies, 1111 Yata, Mishima, Shizuoka 411-8540, Japan
  • Bioproduction Research Institute, National Institute of Advanced Industrial Science and Technology (AIST), Central 4, Higashi 1-1-1, Tsukuba, Ibaraki 305-8562, Japan

References

  1. Ito Y, Thirumurugan T, Serizawa A, Hiratsu K, Ohme-Takagi M, Kurata N. Aberrant vegetative and reproductive development by overexpression and lethality by silencing of OsHAP3E in rice. Plant Sci. 2011 Aug;181(2):105-10. doi: 10.1016/j.plantsci.2011.04.009. PubMed PMID: 21683874.

Structured Information