Difference between revisions of "Os01g0615050"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os01g0615050| Description = Proteinase inhibitor I13, potato inhibitor I family protein| Version = NM_001185534.1 GI:297720202 GeneID:9269181| L...")
 
(Structured Information)
 
(2 intermediate revisions by 2 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
''Oryza sativa chymotrypsin inhibitor-like 1'' ('''''OCPI1''''') is a member of '''serine PI family'''<ref name="ref1"/>.
GeneName = Os01g0615050|
+
 
Description = Proteinase inhibitor I13, potato inhibitor I family protein|
+
==Annotated Information==
Version = NM_001185534.1 GI:297720202 GeneID:9269181|
+
===Function===
Length = 820 bp|
+
*''OCPI1'' might potentially be useful in the '''genetic improvement of drought resistance''' in rice. ''OCPI1'' promoter has a '''bidirectional stress-inducible activity'''. Over-expression ''OCPI1'' had significant effect on '''improving drought resistance''' at the reproductive stage of rice<ref name="ref1"/>.
Definition = Oryza sativa Japonica Group Os01g0615050, complete gene.|
+
 
Source = Oryza sativa Japonica Group
+
*Protease inhibitors play '''important roles in stress''' and '''developmental responses of plants'''. Rice genome contains '''17 putative members''' in chymotrypsin protease inhibitor (ranging in size from 7.21 to 11.9 kDa) gene family with different predicted localization sites<ref name="ref2"/>.
 +
 
 +
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0004867 GO:0004867],[http://amigo.geneontology.org/amigo/term/GO:0009611 GO:0009611]
 +
 
 +
===''OCPI2'' and ''OCPI1'' ===
 +
*Another putative chymotrypsin inhibitor-like gene ([[Os01g0615100|''OCPI2'']])<ref name="ref2"/>, located at the '''immediate upstream''' of the ''OCPI1'' promoter fragment with reverse transcription direction to that of ''OCPI1'' gene, was predicted in the genome annotation database. The ''OCPI2'' gene is supported by a full-length cDNA and is also '''induced by drought and salt stress''' based on cDNA microarray profiling data<ref name="ref1"/><ref name="ref2"/>.
 +
 
 +
*A vector that had GFP and GUS reporter genes in opposite orientations driven by 1881 bp intergenic sequence between the ''OCPI2'' and ''OCPI1''<ref name="ref2"/> (encompassing the region between the translation initiation sites of the two genes) was constructed and shot in onion epidermal cells by particle bombardment<ref name="ref2"/>.
 +
 
 +
===Mutation===
 +
*The full-length cDNA for ''OCPI1'' under the control of CaMV 35S promoter was transformed into rice Zhonghua 11<ref name="ref1"/>.
 +
*RNA-blot analysis showed that more than 50% transgenic plants had obviously higher level of ''OCPI1'' transcript  than WT. The OCPI1-overexpresed transgenic plants contained one to several copies of the transgene based on Southern-blot analysis.
 +
*Drought resistance testing:
 +
**three independent single copy plants
 +
***TL-4
 +
***TL-20
 +
***TL-25
 +
**a non-overexpression transgenic family
 +
**TL-21
 +
*The positive transgenic plants had significantly '''higher grain yield''' and '''seed setting rate''' than the wild type and the negative transgenic control(no over-expression of the transgene) under the severe drought stress conditions, whereas the potential yield of transgenic plants under normal growth conditions was not affected.
 +
*Chymotrypsin-inhibitor activity assay showed that the crude protein of the '''positive''' transgenic plants had '''stronger inhibitory activity''' than the '''negative control'''. Transgenic plants had '''less decrease of total proteins''' than the wild type under drought stress<ref name="ref1"/>.
 +
 
 +
===Expression===
 +
[[File: OCPI1 Expression1.jpg|left|thumb|300px|'''Figure 1.''' ''Northern-blot analysis of OCPI1 expression level under difierent abiotic stresses.(from reference <ref name="ref1"/>).'']]
 +
*The expression of ''OCPI1'' was '''strongly induced by dehydration stresses''' (such as '''drought''' and '''salinity''') and was '''responsive to ABA'''(Fig. 1)<ref name="ref1"/>:
 +
**In the '''drought treatment''', '''very strong induction''' of ''OCPI1'' was detected in the '''partially rolled leaves''' and its expression was decreased in the '''fully rolled leaves'''.
 +
**When the plants were re-watered for 1 day, the expression level of ''OCPI1'' dropped to the level similar as in the non-stressed leaves.
 +
**The ''OCPI1'' transcript level was rapidly increased shortly after '''salt treatment''' and maintained at '''high level of induction''' throughout the development of stress.
 +
**In the '''treatment of ABA''', the transcript level of the gene was '''increased''' shortly after the treatment and peaked at 12 h.
 +
*By histochemical assay, '''slight GUS expression''' was detected in '''callus''', '''leaf''', '''root''', '''stem''', '''sheath''', '''ligule''', '''auricle''', '''glume''', '''rachilla''', '''pistil''', and '''stamen''' of transgenic rice, suggesting that the endogenous OCPI1 gene may express in these tissues or organs with relatively low level under normal growth conditions. GUS activity of the crude protein extract from drought-stressed and salt-stressed transgenic leaves was significantly higher than the non-stressed transgenic samples and the stressed control plants. '''In other words''', the expression of '''beta-glucuronidase(GUS) reporter gene''' under the control of ''OCPI1'' promoter transformed into rice was strongly '''induced by drought''' and '''salt stresses'''<ref name="ref1"/>.
 +
 
 +
 
 +
===Evolution===
 +
*'''sequence identity'''<ref name="ref1"/>:
 +
**Protein sequence of ''OCPI1'' showed '''27–80% identity''' with '''various plant serine-proteinase inhibitors''' including the '''potato inhibitor I family'''.
 +
**The cDNA sequence of ''OCPI1'' showed '''98.5% identity''' with the '''''OsSCI3'''''(unpublished).
 +
**Using the protein sequence of ''OCPI1'' to do BLASTP search against the rice annotation database , at least '''16 putative chymotrypsin inhibitor''' were browsed.
 +
**Phylogenetic analysis of putative rice chymotrypsin inhibitors and a few chymotrypsin inhibitors from other species suggested that plant chymotrypsin inhibitors were '''largely diversified'''.
 +
*''OCPI1'' belongs to the '''serine PI family'''.
 +
 
 +
===Knowledge Extension===
 +
*Proteinase inhibitors (PI) constitute a large and complex group of plant proteins and have an enormous diversity of function by regulating the proteolytic activity of their target proteinases, resulting in the formation of a stable protease inhibitor complex<ref name="ref1"/><ref name="ref3"/>.
 +
*PIs were classified into non-specific and class-specific superfamilies and the later was subcategorized into several families including serine proteinase inhibitor, aspartic proteinase inhibitor, metalloproteinase inhibitor, and cysteine proteinase inhibitor<ref name="ref4"/>. Genes encoding for PIs have been cloned and characterized from a varied range of plant species<ref name="ref5"/>.
 +
*Primarily, PIs are considered important in endogenous as well as exogenous defense against various pathogenic organisms<ref name="ref2"/><ref name="ref5"/>. Some insects and many of the phyto-pathogenic microorganisms produce enzymes causing proteolytic digestion of host proteins. Plants fight against these pathogens through PIs that act against the proteolytic enzymes. Also, plant PIs have been shown to be involved in various physiological and developmental responses<ref name="ref4"/>.
 +
 
 +
==Labs working on this gene==
 +
*National Center of Plant Gene Research (Wuhan), National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, China
 +
*Department of Plant Molecular Biology, University of Delhi South Campus, New Delhi-110021, India
 +
 
 +
==References==
 +
<references>
 +
* <ref name="ref1">
 +
Huang Y, Xiao B, Xiong L. Characterization of a stress responsive proteinase inhibitor gene with positive effect in improving drought resistance in rice[J]. Planta, 2007, 226(1): 73-85.
 +
</ref>
 +
* <ref name="ref2">
 +
Singh A, Sahi C, Grover A. Chymotrypsin protease inhibitor gene family in rice: Genomic organization and evidence for the presence of a bidirectional promoter shared between two chymotrypsin protease inhibitor genes[J]. Gene, 2009, 428(1): 9-19.
 +
</ref>
 +
* <ref name="ref3">
 +
Leung D, Abbenante G, Fairlie D P. Protease inhibitors: current status and future prospects[J]. Journal of medicinal chemistry, 2000, 43(3): 305-341.
 +
</ref>
 +
* <ref name="ref4">
 +
Hibbetts K, Hines B, Williams D. An overview of proteinase inhibitors[J]. Journal of Veterinary Internal Medicine, 1999, 13(4): 302-308.
 +
</ref>
 +
* <ref name="ref5">
 +
Habib H, Fazili K M. Plant protease inhibitors: a defense strategy in plants[J]. Biotechnology and Molecular Biology Review, 2007, 2(3): 68-85.
 +
</ref>
 +
</references>
 +
 
 +
==Structured Information==
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
 
AP = Chromosome 1:26047721..26048540|
 
CDS = 26047832..26048020|
 
GCID = <gbrowseImage1>
 
name=NC_008394:26047721..26048540
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008394:26047721..26048540
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>acccccaagacggagtggcccgagctagtttgccggacgatcaaggaggccaaggagaagatcaaagcagaccgtccagatctcaagattgaggtggttccggtaggcaccatcgtcactcaagagttcgacgagaatcgcgttcgcatctgggtcgacacagtggcaaagacccccacaatcggttaa</cdnaseq>|
 
AA = <aaseq>TPKTEWPELVCRTIKEAKEKIKADRPDLKIEVVPVGTIVTQEFD                    ENRVRIWVDTVAKTPTIG</aaseq>|
 
DNA = <dnaseqindica>521..709#gcagagaagaagcatcgatcaattcaagttaccaagtacgtactcctgtctctaccgtatgtgtctacctgtttaggttctttattatttgaatctacacatgaggagaggttccgttttttgattagtggcgtttggagtcatcgtttcgcttattcacggcatatttgtaaagaaaaataatttatgaataaaacttttatgtgtatgttcttagcgatttaaaagtaaaggctgaaaaataaacttcgataaaaaaaaccttgaaatcagctccaaatttaaggttaaaaatttaaattttaattaataagcataaacataagcgaaaagatgaggctctaattaaggtcccatttgcaacaattttaaagaacaaaatatgattcaacaagtaattaacatagaaaggtgtttctttgatgatctgaagatgcagtaatcatgaattaaccactcataatttgcaggcaacttggatcttctcgattgtttccttgcgaagatgagttcctcttagacccccaagacggagtggcccgagctagtttgccggacgatcaaggaggccaaggagaagatcaaagcagaccgtccagatctcaagattgaggtggttccggtaggcaccatcgtcactcaagagttcgacgagaatcgcgttcgcatctgggtcgacacagtggcaaagacccccacaatcggttaagctgaaaccccgatataggcatacatctagcaagtgtacgtccatgcaagtatttctggatatggtccagtatgataaataaataaataaataaataaataaataaataaa</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001185534.1 RefSeq:Os01g0615050]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 07:18, 13 May 2015

Oryza sativa chymotrypsin inhibitor-like 1 (OCPI1) is a member of serine PI family[1].

Annotated Information

Function

  • OCPI1 might potentially be useful in the genetic improvement of drought resistance in rice. OCPI1 promoter has a bidirectional stress-inducible activity. Over-expression OCPI1 had significant effect on improving drought resistance at the reproductive stage of rice[1].
  • Protease inhibitors play important roles in stress and developmental responses of plants. Rice genome contains 17 putative members in chymotrypsin protease inhibitor (ranging in size from 7.21 to 11.9 kDa) gene family with different predicted localization sites[2].

GO assignment(s): GO:0004867,GO:0009611

OCPI2 and OCPI1

  • Another putative chymotrypsin inhibitor-like gene (OCPI2)[2], located at the immediate upstream of the OCPI1 promoter fragment with reverse transcription direction to that of OCPI1 gene, was predicted in the genome annotation database. The OCPI2 gene is supported by a full-length cDNA and is also induced by drought and salt stress based on cDNA microarray profiling data[1][2].
  • A vector that had GFP and GUS reporter genes in opposite orientations driven by 1881 bp intergenic sequence between the OCPI2 and OCPI1[2] (encompassing the region between the translation initiation sites of the two genes) was constructed and shot in onion epidermal cells by particle bombardment[2].

Mutation

  • The full-length cDNA for OCPI1 under the control of CaMV 35S promoter was transformed into rice Zhonghua 11[1].
  • RNA-blot analysis showed that more than 50% transgenic plants had obviously higher level of OCPI1 transcript than WT. The OCPI1-overexpresed transgenic plants contained one to several copies of the transgene based on Southern-blot analysis.
  • Drought resistance testing:
    • three independent single copy plants
      • TL-4
      • TL-20
      • TL-25
    • a non-overexpression transgenic family
    • TL-21
  • The positive transgenic plants had significantly higher grain yield and seed setting rate than the wild type and the negative transgenic control(no over-expression of the transgene) under the severe drought stress conditions, whereas the potential yield of transgenic plants under normal growth conditions was not affected.
  • Chymotrypsin-inhibitor activity assay showed that the crude protein of the positive transgenic plants had stronger inhibitory activity than the negative control. Transgenic plants had less decrease of total proteins than the wild type under drought stress[1].

Expression

Figure 1. Northern-blot analysis of OCPI1 expression level under difierent abiotic stresses.(from reference [1]).
  • The expression of OCPI1 was strongly induced by dehydration stresses (such as drought and salinity) and was responsive to ABA(Fig. 1)[1]:
    • In the drought treatment, very strong induction of OCPI1 was detected in the partially rolled leaves and its expression was decreased in the fully rolled leaves.
    • When the plants were re-watered for 1 day, the expression level of OCPI1 dropped to the level similar as in the non-stressed leaves.
    • The OCPI1 transcript level was rapidly increased shortly after salt treatment and maintained at high level of induction throughout the development of stress.
    • In the treatment of ABA, the transcript level of the gene was increased shortly after the treatment and peaked at 12 h.
  • By histochemical assay, slight GUS expression was detected in callus, leaf, root, stem, sheath, ligule, auricle, glume, rachilla, pistil, and stamen of transgenic rice, suggesting that the endogenous OCPI1 gene may express in these tissues or organs with relatively low level under normal growth conditions. GUS activity of the crude protein extract from drought-stressed and salt-stressed transgenic leaves was significantly higher than the non-stressed transgenic samples and the stressed control plants. In other words, the expression of beta-glucuronidase(GUS) reporter gene under the control of OCPI1 promoter transformed into rice was strongly induced by drought and salt stresses[1].


Evolution

  • sequence identity[1]:
    • Protein sequence of OCPI1 showed 27–80% identity with various plant serine-proteinase inhibitors including the potato inhibitor I family.
    • The cDNA sequence of OCPI1 showed 98.5% identity with the OsSCI3(unpublished).
    • Using the protein sequence of OCPI1 to do BLASTP search against the rice annotation database , at least 16 putative chymotrypsin inhibitor were browsed.
    • Phylogenetic analysis of putative rice chymotrypsin inhibitors and a few chymotrypsin inhibitors from other species suggested that plant chymotrypsin inhibitors were largely diversified.
  • OCPI1 belongs to the serine PI family.

Knowledge Extension

  • Proteinase inhibitors (PI) constitute a large and complex group of plant proteins and have an enormous diversity of function by regulating the proteolytic activity of their target proteinases, resulting in the formation of a stable protease inhibitor complex[1][3].
  • PIs were classified into non-specific and class-specific superfamilies and the later was subcategorized into several families including serine proteinase inhibitor, aspartic proteinase inhibitor, metalloproteinase inhibitor, and cysteine proteinase inhibitor[4]. Genes encoding for PIs have been cloned and characterized from a varied range of plant species[5].
  • Primarily, PIs are considered important in endogenous as well as exogenous defense against various pathogenic organisms[2][5]. Some insects and many of the phyto-pathogenic microorganisms produce enzymes causing proteolytic digestion of host proteins. Plants fight against these pathogens through PIs that act against the proteolytic enzymes. Also, plant PIs have been shown to be involved in various physiological and developmental responses[4].

Labs working on this gene

  • National Center of Plant Gene Research (Wuhan), National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, China
  • Department of Plant Molecular Biology, University of Delhi South Campus, New Delhi-110021, India

References

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 1.9 Huang Y, Xiao B, Xiong L. Characterization of a stress responsive proteinase inhibitor gene with positive effect in improving drought resistance in rice[J]. Planta, 2007, 226(1): 73-85.
  2. 2.0 2.1 2.2 2.3 2.4 2.5 Singh A, Sahi C, Grover A. Chymotrypsin protease inhibitor gene family in rice: Genomic organization and evidence for the presence of a bidirectional promoter shared between two chymotrypsin protease inhibitor genes[J]. Gene, 2009, 428(1): 9-19.
  3. Leung D, Abbenante G, Fairlie D P. Protease inhibitors: current status and future prospects[J]. Journal of medicinal chemistry, 2000, 43(3): 305-341.
  4. 4.0 4.1 Hibbetts K, Hines B, Williams D. An overview of proteinase inhibitors[J]. Journal of Veterinary Internal Medicine, 1999, 13(4): 302-308.
  5. 5.0 5.1 Habib H, Fazili K M. Plant protease inhibitors: a defense strategy in plants[J]. Biotechnology and Molecular Biology Review, 2007, 2(3): 68-85.

Structured Information