|
|
| (One intermediate revision by one other user not shown) |
| Line 1: |
Line 1: |
| − | {{JaponicaGene|
| + | Please input one-sentence summary here. |
| − | GeneName = Os01g0732000|
| |
| − | Description = Similar to Mitochondrial import receptor subunit TOM7-1 (Translocase of outer membrane 7 kDa subunit 1)|
| |
| − | Version = NM_001050687.1 GI:115439744 GeneID:4324434|
| |
| − | Length = 477 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os01g0732000, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| + | ==Annotated Information== |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| + | ===Function=== |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| + | Please input function information here. |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| + | |
| − | |
| + | ===Expression=== |
| − | Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
| + | Please input expression information here. |
| − | AP = Chromosome 1:32288962..32289438|
| + | |
| − | CDS = 32289194..32289406|
| + | ===Evolution=== |
| − | GCID = <gbrowseImage1>
| + | Please input evolution information here. |
| − | name=NC_008394:32288962..32289438
| + | |
| − | source=RiceChromosome01
| + | You can also add sub-section(s) at will. |
| − | preset=GeneLocation
| + | |
| − | </gbrowseImage1>|
| + | ==Labs working on this gene== |
| − | GSID = <gbrowseImage2>
| + | Please input related labs here. |
| − | name=NC_008394:32288962..32289438
| + | |
| − | source=RiceChromosome01
| + | ==References== |
| − | preset=GeneLocation
| + | Please input cited references here. |
| − | </gbrowseImage2>|
| + | |
| − | CDNA = <cdnaseq>atggcgtccgcggcggcggagaaggggaaggctccggccgacacagagcagacggcggcggcgaccgccgcgcggctcgcggcggagtggaccacgtgggcgatgaagaacgcgaaggtagtggcccactacggattcatcccgctcgtcatcctcatcggcatgaactccgagcccaagccccgcctcgcccagctcctctccccaatctag</cdnaseq>|
| + | ==Structured Information== |
| − | AA = <aaseq>MASAAAEKGKAPADTEQTAAATAARLAAEWTTWAMKNAKVVAHY GFIPLVILIGMNSEPKPRLAQLLSPI</aaseq>|
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]] |
| − | DNA = <dnaseqindica>33..245#aaatcggcaaatcttcccccatcttctcggccatggcgtccgcggcggcggagaaggggaaggctccggccgacacagagcagacggcggcggcgaccgccgcgcggctcgcggcggagtggaccacgtgggcgatgaagaacgcgaaggtagtggcccactacggattcatcccgctcgtcatcctcatcggcatgaactccgagcccaagccccgcctcgcccagctcctctccccaatctaggggtcctagctcaattctcgccagctgctattcggctgttcctcaccacgacccgcgtggatgcgcgtctattggatacggcaacctgtattgcatttcttctacataattttagttcctttctgtttgaatgtttgttaattttgggtctccccaaatagctactgatgagagttaagactttgagttgcaattaattacaaatactggtattatatgtgtgttacggtgt</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001050687.1 RefSeq:Os01g0732000]|
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]]
| |
| − | [[Category:Japonica Chromosome 1]] | |
| − | [[Category:Chromosome 1]]
| |
Please input one-sentence summary here.
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information