Difference between revisions of "Os01g0797600"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os01g0797600| Description = Ethylene responsive element binding factor3 (OsERF3)| Version = NM_001051054.1 GI:115440478 GeneID:4327621| Length =...")
 
(Function)
 
(41 intermediate revisions by 3 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''''Os01g0797600''''' was reported as '''''AP37''''' in 2009 <ref name="ref1" /> by researchers from Korea.
GeneName = Os01g0797600|
+
 
Description = Ethylene responsive element binding factor3 (OsERF3)|
+
==Annotated Information==
Version = NM_001051054.1 GI:115440478 GeneID:4327621|
+
===Gene Symbol===
Length = 1090 bp|
+
*'''''Os01g0797600''''' '''''<=>''''' '''''AP37, OsAP37, OsERF3, OsERF#075, OsERF075, OsERF75, ERF75, AP2/EREBP#004, AP2/EREBP4, OsBIERF2, BIERF2'''''
Definition = Oryza sativa Japonica Group Os01g0797600, complete gene.|
+
 
Source = Oryza sativa Japonica Group
+
===Function===
 +
*'''''AP37''''' (Os01g0797600), is AP2 domain-containing protein, it is found to be significantly up-regulated in both genotypes under cold stress.<ref name="ref1" />
 +
*'''''AP37''''' gene has the potential to improve drought tolerance in rice without causing undesirable growth phenotypes.
 +
 
 +
===Expression===
 +
* The overexpression of '''''AP37''''' and '''''AP59''''' in rice under the control of the constitutive promoter OsCc1 increased the tolerance to drought and high salinity at the vegetative stage.
 +
* Increased tolerance to low temperatures was observed only in OsCc1:AP37 plants. More importantly, the OsCc1:AP37 plants showed significantly enhanced drought tolerance in the field, which increased grain yield by 16% to 57% over controls under severe drought conditions, yet exhibited no significant difference under normal growth conditions.
 +
* In contrast, grain yield in OsCc1:AP59 plants in the field was reduced by 23% to 43% compared with controls under both normal and drought stress conditions.
 +
* Microarray experiments identified 10 and 38 genes that are up-regulated by AP37 and AP59, respectively, in addition to 37 genes that are commonly induced by both factors.
 +
 
 +
==Labs working on this gene==
 +
* School of Biotechnology and Environmental Engineering, Myongji University, Yongin 449–728, Korea
 +
 
 +
==References==
 +
<references>
 +
* <ref name="ref1">
 +
Oh SJ, Kim YS, Kwon CW, Park HK, Jeong JS, Kim JK. Overexpression of the
 +
transcription factor AP37 in rice improves grain yield under drought conditions.
 +
Plant Physiol. 2009 Jul;150(3):1368-79. doi: 10.1104/pp.109.137554. PubMed PMID:
 +
19429605; PubMed Central PMCID: PMC2705040.
 +
</ref>
 +
</references>
 +
 
 +
==Structured Information==
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
 
AP = Chromosome 1:35522840..35523929|
 
CDS = 35522920..35523627|
 
GCID = <gbrowseImage1>
 
name=NC_008394:35522840..35523929
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008394:35522840..35523929
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcgcccagagcagctacggtggagaaggttgctgtggcgccacccaccgggcttggtcttggcgtcggcggaggtgtcggagccgggggtcctcactacaggggcgtccgcaagcgcccgtgggggcgttacgcagcggagatccgtgaccctgccaagaagagccgggtgtggctcggtacctacgacacggcagaggaggccgcccgcgcctacgacgccgccgctcgagagttccggggtgccaaggcaaaaacaaactttccgtttgcatcacagtcgatggtcggctgtggcggcagccccagcagcaatagcacggtagacaccggtggcggcggggttcagacgcctatgcgggccatgcctctgccgccgactctggacttggatttgttccaccgcgcggctgctgtgactgcagtcgccggcaccggcgttcgctttcctttcagaggatatcccgttgcacgtccagcaacgcatccttactttttctatgagcaggctgcagcggctgccgcagctgaggctggataccgtatgatgaagcttgcaccgccggtcaccgtggcggcggttgcacaaagtgactccgactcctcgtcggtggttgatctcgcgccgtcacctccagcggttacggcgaacaaggcggcagctttcgatctggatctgaaccggccgccgccggtagagaactag</cdnaseq>|
 
AA = <aaseq>MAPRAATVEKVAVAPPTGLGLGVGGGVGAGGPHYRGVRKRPWGR                    YAAEIRDPAKKSRVWLGTYDTAEEAARAYDAAAREFRGAKAKTNFPFASQSMVGCGGS                    PSSNSTVDTGGGGVQTPMRAMPLPPTLDLDLFHRAAAVTAVAGTGVRFPFRGYPVARP                    ATHPYFFYEQAAAAAAAEAGYRMMKLAPPVTVAAVAQSDSDSSSVVDLAPSPPAVTAN                    KAAAFDLDLNRPPPVEN</aaseq>|
 
DNA = <dnaseqindica>81..788#cacacccaaacccaacctcccaaaacacccacccggtttaccagagatccgcgcccgccacttgtaaacctgctgcacccatggcgcccagagcagctacggtggagaaggttgctgtggcgccacccaccgggcttggtcttggcgtcggcggaggtgtcggagccgggggtcctcactacaggggcgtccgcaagcgcccgtgggggcgttacgcagcggagatccgtgaccctgccaagaagagccgggtgtggctcggtacctacgacacggcagaggaggccgcccgcgcctacgacgccgccgctcgagagttccggggtgccaaggcaaaaacaaactttccgtttgcatcacagtcgatggtcggctgtggcggcagccccagcagcaatagcacggtagacaccggtggcggcggggttcagacgcctatgcgggccatgcctctgccgccgactctggacttggatttgttccaccgcgcggctgctgtgactgcagtcgccggcaccggcgttcgctttcctttcagaggatatcccgttgcacgtccagcaacgcatccttactttttctatgagcaggctgcagcggctgccgcagctgaggctggataccgtatgatgaagcttgcaccgccggtcaccgtggcggcggttgcacaaagtgactccgactcctcgtcggtggttgatctcgcgccgtcacctccagcggttacggcgaacaaggcggcagctttcgatctggatctgaaccggccgccgccggtagagaactagctcaggatgggttagctgacgactttgtagtttctctcttattttcttctttgatggatatttctctccgatgttttggtcctctgtgtttttgtttagtagcctgtgagagacggaagagccttgtaaatagtttttctgccgagggcgaaattcatcttgggatctgttaattagaacagatcatgccggcgatgagatggactaaaccgtggagtgtatgtattcctttatattagtatgaagaaattattcagaaagtcacaaaaatatctgtgcacactgagtttgattgacgtttt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051054.1 RefSeq:Os01g0797600]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 09:18, 6 March 2017

The rice Os01g0797600 was reported as AP37 in 2009 [1] by researchers from Korea.

Annotated Information

Gene Symbol

  • Os01g0797600 <=> AP37, OsAP37, OsERF3, OsERF#075, OsERF075, OsERF75, ERF75, AP2/EREBP#004, AP2/EREBP4, OsBIERF2, BIERF2

Function

  • AP37 (Os01g0797600), is AP2 domain-containing protein, it is found to be significantly up-regulated in both genotypes under cold stress.[1]
  • AP37 gene has the potential to improve drought tolerance in rice without causing undesirable growth phenotypes.

Expression

  • The overexpression of AP37 and AP59 in rice under the control of the constitutive promoter OsCc1 increased the tolerance to drought and high salinity at the vegetative stage.
  • Increased tolerance to low temperatures was observed only in OsCc1:AP37 plants. More importantly, the OsCc1:AP37 plants showed significantly enhanced drought tolerance in the field, which increased grain yield by 16% to 57% over controls under severe drought conditions, yet exhibited no significant difference under normal growth conditions.
  • In contrast, grain yield in OsCc1:AP59 plants in the field was reduced by 23% to 43% compared with controls under both normal and drought stress conditions.
  • Microarray experiments identified 10 and 38 genes that are up-regulated by AP37 and AP59, respectively, in addition to 37 genes that are commonly induced by both factors.

Labs working on this gene

  • School of Biotechnology and Environmental Engineering, Myongji University, Yongin 449–728, Korea

References

  1. 1.0 1.1 Oh SJ, Kim YS, Kwon CW, Park HK, Jeong JS, Kim JK. Overexpression of the transcription factor AP37 in rice improves grain yield under drought conditions. Plant Physiol. 2009 Jul;150(3):1368-79. doi: 10.1104/pp.109.137554. PubMed PMID: 19429605; PubMed Central PMCID: PMC2705040.

Structured Information