Difference between revisions of "Os09g0306500"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os09g0306500| Description = DVL family protein| Version = NM_001188827.1 GI:297726784 GeneID:9269108| Length = 120 bp| Definition = Oryza sativ...")
 
 
(One intermediate revision by one other user not shown)
Line 1: Line 1:
−
{{JaponicaGene|
+
Please input one-sentence summary here.
−
GeneName = Os09g0306500|
 
−
Description = DVL family protein|
 
−
Version = NM_001188827.1 GI:297726784 GeneID:9269108|
 
−
Length = 120 bp|
 
−
Definition = Oryza sativa Japonica Group Os09g0306500, complete gene.|
 
−
Source = Oryza sativa Japonica Group
 
  
−
  ORGANISM  Oryza sativa Japonica Group
+
==Annotated Information==
−
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
===Function===
−
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
Please input function information here.
−
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
 
−
|
+
===Expression===
−
Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|
+
Please input expression information here.
−
AP = Chromosome 9:8440973..8441092|
+
 
−
CDS = 8440973..8441092|
+
===Evolution===
−
GCID = <gbrowseImage1>
+
Please input evolution information here.
−
name=NC_008402:8440973..8441092
+
 
−
source=RiceChromosome09
+
You can also add sub-section(s) at will.
−
preset=GeneLocation
+
 
−
</gbrowseImage1>|
+
==Labs working on this gene==
−
GSID = <gbrowseImage2>
+
Please input related labs here.
−
name=NC_008402:8440973..8441092
+
 
−
source=RiceChromosome09
+
==References==
−
preset=GeneLocation
+
Please input cited references here.
−
</gbrowseImage2>|
+
 
−
CDNA = <cdnaseq>atgaggatgggtgctcaagacatgaagctcaagggcctcaagagggctctcaaggagcagaaggcaaggctctacatcatccgccgatgcgttgcgatgctcataagatggcatgattga</cdnaseq>|
+
==Structured Information==
−
AA = <aaseq>MRMGAQDMKLKGLKRALKEQKARLYIIRRCVAMLIRWHD</aaseq>|
+
[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 9]]
−
DNA = <dnaseqindica>1..120#atgaggatgggtgctcaagacatgaagctcaagggcctcaagagggctctcaaggagcagaaggcaaggctctacatcatccgccgatgcgttgcgatgctcataagatggcatgattga</dnaseqindica>|
 
−
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001188827.1 RefSeq:Os09g0306500]|
 
−
}}
 
−
[[Category:Genes]]
 
−
[[Category:Japonica mRNA]]
 
−
[[Category:Oryza Sativa Japonica Group]]
 
−
[[Category:Japonica Genes]]
 
−
[[Category:Japonica Chromosome 9]]
 
−
[[Category:Chromosome 9]]
 

Latest revision as of 13:19, 14 May 2015

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information