Difference between revisions of "Os09g0474000"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os09g0474000| Description = Eukaryotic transcription factor, DNA-binding domain containing protein| Version = NM_001069989.1 GI:115479720 GeneID:...")
 
 
(2 intermediate revisions by 2 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''''Os09g0474000''''' was reported as '''''OsbZIP73''''' in 2008 <ref name="ref1" /> by researchers from India.  
GeneName = Os09g0474000|
 
Description = Eukaryotic transcription factor, DNA-binding domain containing protein|
 
Version = NM_001069989.1 GI:115479720 GeneID:4347354|
 
Length = 837 bp|
 
Definition = Oryza sativa Japonica Group Os09g0474000, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
+
==Annotated Information==
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
===Gene Symbol===
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
*'''''Os09g0474000''''' '''<=>''' '''''OsbZIP73,OsbZIP, bZIP73'''''
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
===Function===
|
+
* The basic leucine (Leu) zipper (bZIP) proteins compose a family of transcriptional regulators present exclusively in eukaryotes.
Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|
+
* The '''''OsbZIP''''' proteins characteristically harbor a bZIP domain composed of two structural features: a DNA-binding basic region and the Leu zipper dimerization region.
AP = Chromosome 9:18776338..18777174|
+
* bZIP proteins have been shown to regulate diverse plant-specific phenomena, including seed maturation and germination, floral induction and development, and photomorphogenesis, and are also involved in stress and hormone signaling.
CDS = 18776550..18777071|
+
 
GCID = <gbrowseImage1>
+
===Expression===
name=NC_008402:18776338..18777174
+
* The researchers from India find specific or coexpression patterns of rice bZIP transcription factors starting from floral transition to various stages of panicle and seed development.
source=RiceChromosome09
+
* bZIP transcription factor-encoding genes in rice also displayed differential expression patterns in rice seedlings in response to abiotic stress and light irradiation.
preset=GeneLocation
+
 
</gbrowseImage1>|
+
===Evolution===
GSID = <gbrowseImage2>
+
* The phylogenetic relationship among rice bZIP domains as well as with bZIP domains from other plant bZIP factors suggests that homologous bZIP domains exist in plants.
name=NC_008402:18776338..18777174
+
* Similar intron/exon structural patterns were observed in the basic and hinge regions of their bZIP domains.  
source=RiceChromosome09
+
* Detailed sequence analysis has been done to identify additional conserved motifs outside the bZIP domain and to predict their DNA-binding site specificity as well as dimerization properties, which has helped classify them into different groups and subfamilies, respectively.
preset=GeneLocation
+
<br>
</gbrowseImage2>|
+
'''''You can also add sub-section(s) at will.'''''
CDNA = <cdnaseq>atgctgcaccaccattaccatggcgaggtggccagcctgcactgcctctcacctccaagcctaccattcagttcccactaccacagcaacatgatcaccatggcaccctcgcccttccacttcccagcagctacctgtgaacctatccaggaattgctccctgtggtagcgggcaatcgcccagccggctctggcagcacagatgacgcctaccagatggcagcggaggaggagcggaggcggcggaggatgatctccaaccgggagtcggcacggcggtcgcgcatgcgcaagcagcggcagctcagcgagctgagggggcaggttgtccacctccgtgacgccaaccgccgcctccttgatgagctcaaccaagcaatgaggggctgcagtgatgtccactgcgagaacgcccggctcaggaaggagagggccgagctccagaccaagctcgagcacctcatgcaagcacagaagaataacacctcgccgagctcctcacagccatgcgagaatatttga</cdnaseq>|
+
 
AA = <aaseq>MLHHHYHGEVASLHCLSPPSLPFSSHYHSNMITMAPSPFHFPAA                    TCEPIQELLPVVAGNRPAGSGSTDDAYQMAAEEERRRRRMISNRESARRSRMRKQRQL                    SELRGQVVHLRDANRRLLDELNQAMRGCSDVHCENARLRKERAELQTKLEHLMQAQKN                    NTSPSSSQPCENI</aaseq>|
+
==Labs working on this gene==
DNA = <dnaseqindica>104..625#cgctcagagagagcaaattcttcagtaagcagaatcaaagcagattaaccctcatctacttctggccctctaagagttctccactaagcaagcgaaaacagccatgctgcaccaccattaccatggcgaggtggccagcctgcactgcctctcacctccaagcctaccattcagttcccactaccacagcaacatgatcaccatggcaccctcgcccttccacttcccagcagctacctgtgaacctatccaggaattgctccctgtggtagcgggcaatcgcccagccggctctggcagcacagatgacgcctaccagatggcagcggaggaggagcggaggcggcggaggatgatctccaaccgggagtcggcacggcggtcgcgcatgcgcaagcagcggcagctcagcgagctgagggggcaggttgtccacctccgtgacgccaaccgccgcctccttgatgagctcaaccaagcaatgaggggctgcagtgatgtccactgcgagaacgcccggctcaggaaggagagggccgagctccagaccaagctcgagcacctcatgcaagcacagaagaataacacctcgccgagctcctcacagccatgcgagaatatttgattactgaataataaatcattcttaattatctcctcattttaactacgaggattattattagtatatcaaaataagacatgttttgagatgcttccttcggcttctgtttttttgttttatcttttatgtacgggaatattctaactgcccattattgacatctttttgtcaaggtggctaagataaatatggattgagcctattggcgagtt</dnaseqindica>|
+
* Interdisciplinary Centre for Plant Genomics and Department of Plant Molecular Biology, University of Delhi South Campus, New Delhi 110021, India
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001069989.1 RefSeq:Os09g0474000]|
+
 
}}
+
==References==
[[Category:Genes]]
+
<references>
[[Category:Japonica mRNA]]
+
* <ref name="ref1">
[[Category:Oryza Sativa Japonica Group]]
+
Nijhawan A, Jain M, Tyagi AK, Khurana JP. Genomic survey and gene expression
[[Category:Japonica Genes]]
+
analysis of the basic leucine zipper transcription factor family in rice. Plant
[[Category:Japonica Chromosome 9]]
+
Physiol. 2008 Feb;146(2):333-50. PubMed PMID: 18065552; PubMed Central PMCID:
[[Category:Chromosome 9]]
+
PMC2245831.
 +
</ref>
 +
</references>
 +
 
 +
==Structured Information==
 +
[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 9]]

Latest revision as of 05:15, 25 February 2017

The rice Os09g0474000 was reported as OsbZIP73 in 2008 [1] by researchers from India.

Annotated Information

Gene Symbol

  • Os09g0474000 <=> OsbZIP73,OsbZIP, bZIP73

Function

  • The basic leucine (Leu) zipper (bZIP) proteins compose a family of transcriptional regulators present exclusively in eukaryotes.
  • The OsbZIP proteins characteristically harbor a bZIP domain composed of two structural features: a DNA-binding basic region and the Leu zipper dimerization region.
  • bZIP proteins have been shown to regulate diverse plant-specific phenomena, including seed maturation and germination, floral induction and development, and photomorphogenesis, and are also involved in stress and hormone signaling.

Expression

  • The researchers from India find specific or coexpression patterns of rice bZIP transcription factors starting from floral transition to various stages of panicle and seed development.
  • bZIP transcription factor-encoding genes in rice also displayed differential expression patterns in rice seedlings in response to abiotic stress and light irradiation.

Evolution

  • The phylogenetic relationship among rice bZIP domains as well as with bZIP domains from other plant bZIP factors suggests that homologous bZIP domains exist in plants.
  • Similar intron/exon structural patterns were observed in the basic and hinge regions of their bZIP domains.
  • Detailed sequence analysis has been done to identify additional conserved motifs outside the bZIP domain and to predict their DNA-binding site specificity as well as dimerization properties, which has helped classify them into different groups and subfamilies, respectively.


You can also add sub-section(s) at will.

Labs working on this gene

  • Interdisciplinary Centre for Plant Genomics and Department of Plant Molecular Biology, University of Delhi South Campus, New Delhi 110021, India

References

  1. Nijhawan A, Jain M, Tyagi AK, Khurana JP. Genomic survey and gene expression analysis of the basic leucine zipper transcription factor family in rice. Plant Physiol. 2008 Feb;146(2):333-50. PubMed PMID: 18065552; PubMed Central PMCID: PMC2245831.

Structured Information