Difference between revisions of "Os01g0940000"

From RiceWiki
Jump to: navigation, search
Line 1: Line 1:
Please input one-sentence summary here.
+
OsCKX4(''ren1-D''),funtion as cytokinin oxidase/dehydrogenases, integrates cytokinin and auxin
 +
signaling to control rice crown root formation.
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
[[File:Fdugdnd.png|right|thumb|250px| ''Phenotypes of the ren1-D mutant<ref name="ref1" />).'']]
 +
OsCKX4 is induced by
 +
exogenous auxin and cytokinin in the roots. Furthermore, one-hybrid assays revealed that OsCKX4
 +
is a direct binding target of both auxin response factor OsARF25 and the cytokinin response
 +
regulators ORR2 and ORR3. Overexpression and RNAi of OsCKX4 confirmed that OsCKX4 plays
 +
a positive role in crown root formation. Moreover, expression analysis revealed a significant
 +
alteration in the expression of auxin-related genes in the ren1-D mutants, indicating that the
 +
OsCKX4 mediates crown root development by integrating the interaction between cytokinin and
 +
auxin. Transgenic plants harboring OsCKX4 under the control of a root-specific promoter RCc3
 +
displayed enhanced root development without affecting their shoot parts, suggesting that this
 +
strategy could be a powerful tool in rice root engineering<ref name="ref1" />.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
[[File:Scfysb.png|right|thumb|350px| ''Expression pattern of OsCKX4 and subcellular localization of OsCKX4.<ref name="ref1" />).'']]
 +
qRT-PCR tests indicate OsCKX4 was predominantly expressed in leaf blades and roots, but hardly detected in stems and
 +
panicles(Fig. 2A).
 +
OsCKX4 promoter:GUS cassette showed that GUS was detected in the primary roots, lateral roots,
 +
and crown roots(Fig. 2B-1, 2, 3)..GUS was observed to be strongest at the base of
 +
shoots where crown root primordia were formed (Fig. 2B-4). Apart from roots, GUS activity was
 +
detected at a relatively high level in mature leaf sheaths (Fig. 2B-6) and mature leaf blades (Fig.
 +
2B-7), suggesting that OsCKX4 might also play a role in regulating other aspects of plant
 +
development<ref name="ref1" />.
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
[[File:Ynjdhfudfhdfj.png|left|thumb|200px| ''Phylogenetic tree of all 66 full-length
 +
cytokinin oxidase ⁄ dehydrogenases 2 (CKX2) family
 +
members from rice, brachypodium, sorghum,
 +
maize and foxtail millet, as well as full-length
 +
members from wheat and barley.<ref name="ref2" />).'']]
 +
a total of 66 full-length cereal CKX
 +
proteins originating from rice (11 members),
 +
brachypodium (11), sorghum (11), foxtail millet (11), maize
 +
(12), wheat (six) and barley (four) were analysed. CKX proteins from
 +
sequenced grasses grouped into four major phylogenetic clusters,
 +
with clades I and II each divided into two subclades. The
 +
seven full-length wheat ⁄ barley CKX2 proteins are found within
 +
clade Ia, with TaCKX2.3 clustering with HvCKX2.1 and
 +
HvCKX2.2, while TaCKX2.1 and TaCKX2.2 group separately.
 +
The occurrence of two or more CKX2 paralogs is specific to the
 +
Triticeae. The overall tree topography of CKX2 proteins agrees
 +
with established evolutionary relationships between the grass
 +
species investigated, with those from the Poideae (wheat, barley,
 +
brachypodium) clustering together, followed by members
 +
from the Ehrhartoideae (rice) and Panicoideae (foxtail millet,
 +
sorghum and maize). CKX1 proteins from all five sequenced
 +
grasses cluster within the second major phylogenetic grouping
 +
within clade Ia, supporting their close evolutionary relationship
 +
with the CKX2 proteins (as implied by their physical proximity
 +
to each other in the five sequenced grass species investigated).
 +
Clade Ib includes orthologs of OsCKX6 and OsCKX7, as well as OsCKX10 orthologs. CKX4 and CKX9 proteins group within
 +
clade IIa. Clades III and IV contain two (CKX3, CKX8) and one
 +
(CKX11) CKX family member, respectively. Phylogenetic analysis
 +
of barley and wheat CKX members for which only partial protein
 +
sequence data were available showed all members to
 +
group within the expected clades<ref name="ref2" />
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
chengcai chu. Institute of Genetics and Developmental Biology, Chinese Academy of Sciences; http://chulab.genetics.ac.cn
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
<ref name="ref1">
 +
Gao, S., Fang, J., Xu, F., Wang, W., Sun, X., Chu, J., ... & Chu, C. (2014). A cytokinin oxidase/dehydrogenase gene OsCKX4 integrates cytokinin and auxin signaling to control rice crown root formation. Plant physiology, pp-114.</ref>
 +
<ref name="ref2">
 +
Mameaux, S., Cockram, J., Thiel, T., Steuernagel, B., Stein, N., Taudien, S., ... & Powell, W. (2012). Molecular, phylogenetic and comparative genomic analysis of the cytokinin oxidase/dehydrogenase gene family in the Poaceae. Plant biotechnology journal, 10(1), 67-82./ref>
 +
</references>
 +
 
  
 
==Structured Information==
 
==Structured Information==

Revision as of 06:59, 23 May 2014

OsCKX4(ren1-D),funtion as cytokinin oxidase/dehydrogenases, integrates cytokinin and auxin signaling to control rice crown root formation.

Annotated Information

Function

Phenotypes of the ren1-D mutant[1]).

OsCKX4 is induced by exogenous auxin and cytokinin in the roots. Furthermore, one-hybrid assays revealed that OsCKX4 is a direct binding target of both auxin response factor OsARF25 and the cytokinin response regulators ORR2 and ORR3. Overexpression and RNAi of OsCKX4 confirmed that OsCKX4 plays a positive role in crown root formation. Moreover, expression analysis revealed a significant alteration in the expression of auxin-related genes in the ren1-D mutants, indicating that the OsCKX4 mediates crown root development by integrating the interaction between cytokinin and auxin. Transgenic plants harboring OsCKX4 under the control of a root-specific promoter RCc3 displayed enhanced root development without affecting their shoot parts, suggesting that this strategy could be a powerful tool in rice root engineering[1].

Expression

Expression pattern of OsCKX4 and subcellular localization of OsCKX4.[1]).

qRT-PCR tests indicate OsCKX4 was predominantly expressed in leaf blades and roots, but hardly detected in stems and panicles(Fig. 2A). OsCKX4 promoter:GUS cassette showed that GUS was detected in the primary roots, lateral roots, and crown roots(Fig. 2B-1, 2, 3)..GUS was observed to be strongest at the base of shoots where crown root primordia were formed (Fig. 2B-4). Apart from roots, GUS activity was detected at a relatively high level in mature leaf sheaths (Fig. 2B-6) and mature leaf blades (Fig. 2B-7), suggesting that OsCKX4 might also play a role in regulating other aspects of plant development[1].

Evolution

Phylogenetic tree of all 66 full-length cytokinin oxidase ⁄ dehydrogenases 2 (CKX2) family members from rice, brachypodium, sorghum, maize and foxtail millet, as well as full-length members from wheat and barley.[2]).

a total of 66 full-length cereal CKX proteins originating from rice (11 members), brachypodium (11), sorghum (11), foxtail millet (11), maize (12), wheat (six) and barley (four) were analysed. CKX proteins from sequenced grasses grouped into four major phylogenetic clusters, with clades I and II each divided into two subclades. The seven full-length wheat ⁄ barley CKX2 proteins are found within clade Ia, with TaCKX2.3 clustering with HvCKX2.1 and HvCKX2.2, while TaCKX2.1 and TaCKX2.2 group separately. The occurrence of two or more CKX2 paralogs is specific to the Triticeae. The overall tree topography of CKX2 proteins agrees with established evolutionary relationships between the grass species investigated, with those from the Poideae (wheat, barley, brachypodium) clustering together, followed by members from the Ehrhartoideae (rice) and Panicoideae (foxtail millet, sorghum and maize). CKX1 proteins from all five sequenced grasses cluster within the second major phylogenetic grouping within clade Ia, supporting their close evolutionary relationship with the CKX2 proteins (as implied by their physical proximity to each other in the five sequenced grass species investigated). Clade Ib includes orthologs of OsCKX6 and OsCKX7, as well as OsCKX10 orthologs. CKX4 and CKX9 proteins group within clade IIa. Clades III and IV contain two (CKX3, CKX8) and one (CKX11) CKX family member, respectively. Phylogenetic analysis of barley and wheat CKX members for which only partial protein sequence data were available showed all members to group within the expected clades[2]

You can also add sub-section(s) at will.

Labs working on this gene

chengcai chu. Institute of Genetics and Developmental Biology, Chinese Academy of Sciences; http://chulab.genetics.ac.cn

References

  1. 1.0 1.1 1.2 1.3 Gao, S., Fang, J., Xu, F., Wang, W., Sun, X., Chu, J., ... & Chu, C. (2014). A cytokinin oxidase/dehydrogenase gene OsCKX4 integrates cytokinin and auxin signaling to control rice crown root formation. Plant physiology, pp-114.
  2. 2.0 2.1 Cite error: Invalid <ref> tag; no text was provided for refs named ref2


Structured Information

Gene Name

Os01g0940000

Description

FAD linked oxidase, N-terminal domain containing protein

Version

NM_001051888.1 GI:115442146 GeneID:4326515

Length

2781 bp

Definition

Oryza sativa Japonica Group Os01g0940000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:43095050..43097830

Sequence Coding Region

43095276..43095888,43096010..43096137,43096247..43096507,43096642..43096904,43096995..43097319

Expression

GEO Profiles:Os01g0940000

Genome Context

<gbrowseImage1> name=NC_008394:43095050..43097830 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:43095050..43097830 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgcggggagccatgaagccgtcgatcgtgcactgcctcaagctgctcatgctgctggcgctcggcggggtcaccatgcacgtccccgacgaggacgacgtggtcgcgtcgctcggggcgctgcgcctcgacggccatttcagcttcgacgacgcccacgccgccgcccgggacttcggcaaccggtgcagcctcctgccggcggccgtgctccaccctggctcggtgtccgacgtcgccgccaccgtcaggcgcgtgttccagctgggcaggagctcgccgctcaccgtcgcggcgcgcgggcacggccactcgctcctcggccagtcccaggccgccggcgggatcgtcgtcaagatggagtccctcgccgccgccgcagccagggcggtgcgggtgcacggcggcgcgtcgccccacgtggacgccccgggcggcgagctctggatcaacgtgctgcatgagacgctcaagcacgggctggcgcccaggtcatggaccgactacctccatctcacagtcggtggcaccttgtcgaatgcgggggtcagcgggcaggcgttccggcatggaccgcaggtcagcaatgtcaaccaactggagattgtgacagggaggggagaagttgtcacctgctcgcacgaggtgaactctgatctcttctacgctgctcttggcggcctgggccagtttgggatcatcaccagggctcggattgctcttgaacctgctccaaagatggtgcggtggatacgtgttctctactcggactttgagaccttcaccgaggaccaggagaagctgatcgcgtctgagaagaccttcgactacatcgaagggtttgtgatcataaacaggacaggcatcctcaacaactggaggacgtcgttcaagccacaggacccagtgcaggcaagccagttccagtcggatggaagagtgctatactgccttgagctgacgatgaacttcaaccacgatgaggctgacatcatggaacaggaagttggtgcgctgctatctcgactcagatacatatcgtccactctattctacaccgatgtcacatacctggagttcttggacagggtgcacacttctgagctgaagctgagggctcaaggcctctgggaagtcccacacccgtggctgaatcttctgatcccaaggagcacagtccacaaatttgcaaaggaagtcttcggcaagatcctaaaagatagcaacaatggtcccatactgctttacccagtgaacagaaccaagtgggacaacagaacatcagtggtcataccagatgaagaaattttctacctggttgggttcctatcttcagcaccatcatcctcaggtcatggtagtgtcgaacatgcaatgaacctgaacaacaaaatagtggacttctgtgaaaagaatggtgttgggatgaaacagtatctagcaccctacactacacagaagcagtggaaagcccacttcggagcaaggtgggagacatttgaacggaggaaacacacgtacgatcccctagcaatcctagctccagggcagagaatatttccaaaggcatcactacctatgtccttgtga</cdnaseq>

Protein Sequence

<aaseq>MRGAMKPSIVHCLKLLMLLALGGVTMHVPDEDDVVASLGALRLD GHFSFDDAHAAARDFGNRCSLLPAAVLHPGSVSDVAATVRRVFQLGRSSPLTVAARGH GHSLLGQSQAAGGIVVKMESLAAAAARAVRVHGGASPHVDAPGGELWINVLHETLKHG LAPRSWTDYLHLTVGGTLSNAGVSGQAFRHGPQVSNVNQLEIVTGRGEVVTCSHEVNS DLFYAALGGLGQFGIITRARIALEPAPKMVRWIRVLYSDFETFTEDQEKLIASEKTFD YIEGFVIINRTGILNNWRTSFKPQDPVQASQFQSDGRVLYCLELTMNFNHDEADIMEQ EVGALLSRLRYISSTLFYTDVTYLEFLDRVHTSELKLRAQGLWEVPHPWLNLLIPRST VHKFAKEVFGKILKDSNNGPILLYPVNRTKWDNRTSVVIPDEEIFYLVGFLSSAPSSS GHGSVEHAMNLNNKIVDFCEKNGVGMKQYLAPYTTQKQWKAHFGARWETFERRKHTYD PLAILAPGQRIFPKASLPMSL</aaseq>

Gene Sequence

<dnaseqindica>227..839#961..1088#1198..1458#1593..1855#1946..2270#cctccccttacctaccttggtggcctcctctcgctctcgctctccttctcttcctgcacctgttgcacccccaacaactctcactcactgccagtgtcaagcaagattatacagcttggtctcatctcttaattccaagcttgtttcaccgacctgccaaactcgattgatccacagatagatagtacttctggttgggatcttgagcttatatagaccaggaagcatgcggggagccatgaagccgtcgatcgtgcactgcctcaagctgctcatgctgctggcgctcggcggggtcaccatgcacgtccccgacgaggacgacgtggtcgcgtcgctcggggcgctgcgcctcgacggccatttcagcttcgacgacgcccacgccgccgcccgggacttcggcaaccggtgcagcctcctgccggcggccgtgctccaccctggctcggtgtccgacgtcgccgccaccgtcaggcgcgtgttccagctgggcaggagctcgccgctcaccgtcgcggcgcgcgggcacggccactcgctcctcggccagtcccaggccgccggcgggatcgtcgtcaagatggagtccctcgccgccgccgcagccagggcggtgcgggtgcacggcggcgcgtcgccccacgtggacgccccgggcggcgagctctggatcaacgtgctgcatgagacgctcaagcacgggctggcgcccaggtcatggaccgactacctccatctcacagtcggtggcaccttgtcgaatgcgggggtcagcgggcaggcgttccggcatggaccgcaggtcagcaatgtcaaccaactggagattgtgacaggtctctgacaaacccgccacgcacgataaaaacatatacagccgctctaatactactactacaacaacagcataggaattagatgactaaatttgttcttgctatgaactaccaaatgcagggaggggagaagttgtcacctgctcgcacgaggtgaactctgatctcttctacgctgctcttggcggcctgggccagtttgggatcatcaccagggctcggattgctcttgaacctgctccaaagatggtaacatcaagcaatcaattttgtgtcaactcaatgatggaaaaactggccattatttgattcgtttcattggtgcatgttcacgtactaattagatatacaatgacaggtgcggtggatacgtgttctctactcggactttgagaccttcaccgaggaccaggagaagctgatcgcgtctgagaagaccttcgactacatcgaagggtttgtgatcataaacaggacaggcatcctcaacaactggaggacgtcgttcaagccacaggacccagtgcaggcaagccagttccagtcggatggaagagtgctatactgccttgagctgacgatgaacttcaaccacgatgaggctgacatcatggaacaggtgagctgagttaattattttctctttgcatcaagatgttgacgtatcaggaaatatatatataggatattagatagcccaggccgtgcaggtgttttttaattaatggttggtgtttgtatatgtatttacaggaagttggtgcgctgctatctcgactcagatacatatcgtccactctattctacaccgatgtcacatacctggagttcttggacagggtgcacacttctgagctgaagctgagggctcaaggcctctgggaagtcccacacccgtggctgaatcttctgatcccaaggagcacagtccacaaatttgcaaaggaagtcttcggcaagatcctaaaagatagcaacaatggtcccatactgctttacccagtgaacagaaccaagtaaatataactagccaaattgcagtcctatactatactatccagtttcaagttttggtaactaaaaaaagtttaacatggttgatgcaggtgggacaacagaacatcagtggtcataccagatgaagaaattttctacctggttgggttcctatcttcagcaccatcatcctcaggtcatggtagtgtcgaacatgcaatgaacctgaacaacaaaatagtggacttctgtgaaaagaatggtgttgggatgaaacagtatctagcaccctacactacacagaagcagtggaaagcccacttcggagcaaggtgggagacatttgaacggaggaaacacacgtacgatcccctagcaatcctagctccagggcagagaatatttccaaaggcatcactacctatgtccttgtgacagtatatgctgtgaaaaggcttttgtagagcatatgttgtacaaaaatgtagcgaaaatatcctttgtaaagacgaaatctacggaaggtagcttaaagaacacagcggggcaaccagtagactagaactcaagaagtagtggaagatacctcacaaaagacttcaaagcaaagcagcgtggccttaactctggttgcagctttggaggcaaatgattggaggattacagtggtcctagcaactgaagtccagctgttgttacagcatagagaagagctgtgctacctcaatgatcactaaatcactgactagtgtaactcatgttaagttgtttgtgttcagctaacaacactgcagaaggtagcatcagggtagacccttgattagcaaataacacagcctgttgcatgtgagtactatctgcataaatgcagcagattacattagtttttatgaatcgaatgttatgtttgcaaatgttaaagaaaaaaacagcaaagtttcttatt</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0940000, RefSeq:Os01g0940000