Difference between revisions of "Os02g0747900"

From RiceWiki
Jump to: navigation, search
(Function)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
 
 +
Os02g0747900 (LOC_Os02g51320 in MSU Rice Genome Annotation Project) is an atypical bHLH of unknown function and was named Os170 and belonging to subfamily 16 of bHLH proteins in a phylogenetic study (Carretero-Paulet et al. 2010). Phylogenetic analysis of amino acid sequences of members of subfamily 16 revealed that the closest homolog of Os02g0747900 is a rice bHLH protein BRASSIONOSTEROID UPREGULATED 1 (BU1, Tanaka et al. 2009) with 90.8% amino acid identity . Many members of subfamily 16, such as rice Ili1 and BU1, Arabidopsis PRE1 and ATBS1 and tomato Style2.1, were reported to control cell elongation and expansion in specific organs probably through heterodimerization with other bHLH proteins (Wang et al. 2009, Zhang et al. 2009). In addition,  PGL1 (Os03g0171300) as a positive regulator of the grain length and weight of rice (Heang and Sassa 2012). However, the function of Os02g0747900 has not been elucidated yet.  Os02g0747900 as PGL2 (POSITIVE REGULATOR OF GRAIN LENGTH 2) based on functional analyses . PGL2 has 52.9% and 94.3% whole amino acid identity and similarity, respectively, to PGL1 and 48.1% and 98.1% identity and similarity, respectively, in the HLH domain alone.
  
 
===Expression===
 
===Expression===

Revision as of 12:02, 4 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Os02g0747900 (LOC_Os02g51320 in MSU Rice Genome Annotation Project) is an atypical bHLH of unknown function and was named Os170 and belonging to subfamily 16 of bHLH proteins in a phylogenetic study (Carretero-Paulet et al. 2010). Phylogenetic analysis of amino acid sequences of members of subfamily 16 revealed that the closest homolog of Os02g0747900 is a rice bHLH protein BRASSIONOSTEROID UPREGULATED 1 (BU1, Tanaka et al. 2009) with 90.8% amino acid identity . Many members of subfamily 16, such as rice Ili1 and BU1, Arabidopsis PRE1 and ATBS1 and tomato Style2.1, were reported to control cell elongation and expansion in specific organs probably through heterodimerization with other bHLH proteins (Wang et al. 2009, Zhang et al. 2009). In addition, PGL1 (Os03g0171300) as a positive regulator of the grain length and weight of rice (Heang and Sassa 2012). However, the function of Os02g0747900 has not been elucidated yet. Os02g0747900 as PGL2 (POSITIVE REGULATOR OF GRAIN LENGTH 2) based on functional analyses . PGL2 has 52.9% and 94.3% whole amino acid identity and similarity, respectively, to PGL1 and 48.1% and 98.1% identity and similarity, respectively, in the HLH domain alone.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os02g0747900

Description

Helix-loop-helix DNA-binding domain containing protein

Version

NM_001054653.2 GI:297599921 GeneID:4330725

Length

1269 bp

Definition

Oryza sativa Japonica Group Os02g0747900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:32310829..32312097

Sequence Coding Region

32311348..32311509

Expression

GEO Profiles:Os02g0747900

Genome Context

<gbrowseImage1> name=NC_008395:32310829..32312097 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:32310829..32312097 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgcaggcgtcgacgacgaagctgctgaaggagacgtgcaactacatcaagagccttcaccgggaggtggatgacctcagcgaccggctgtccgacctcatggccaccatggatcacaacagccccggcgcggagatcatccgcagcatcctccgctcctga</cdnaseq>

Protein Sequence

<aaseq>MQASTTKLLKETCNYIKSLHREVDDLSDRLSDLMATMDHNSPGA EIIRSILRS</aaseq>

Gene Sequence

<dnaseqindica>589..750#acacacttctcccatccagctagcttttgcagatcgagcgaaccttcaacacaaaccggccagcttgttcctctcctctctctctctctctctctctctctcggtcgcagccagctaacttcgagtgtgaagaacactcacgctagctagctttctcaaggccacatacgctagctccgcctccacgcgcggcgtacgtctagtttgattgaggctgaagagagtgcgtgtttggtagaagaggctagctgttgacgatgtcgagcagaaggtcgtcgcgtggctccatctcggaggaggaaatcaacgagctcatctccaagctccagtcgctgctccccaactcacgccgacgcggctccagccaggtagctaaccacattcttgcatacgccaactgcttgtgtactgctagtgtgctgccactttggtagtagctataggtttgctttcggtgaacacagaagtggctactactagaacaatccacacactactatagtcgtgtgtgtgggtggtggtttggggttaagcccgtgagcgattcggtgtgtgttttgtctgcacgagacgagtaatgtggcgttaatgcaggcgtcgacgacgaagctgctgaaggagacgtgcaactacatcaagagccttcaccgggaggtggatgacctcagcgaccggctgtccgacctcatggccaccatggatcacaacagccccggcgcggagatcatccgcagcatcctccgctcctgatcggcaagcagcagcagcaagcggcaccggccggccggccggcctatgtcgacgacgagataggccgggccggccgggcaacgcccgcggcgccaattaatcaagcgtacgtcctgccggcgccattctccggccaccagagagcatttagctagggtatatatatctacatatataaaatatttatgtcgtatgtccctccccaaatgtacgagccacgcttacacgcgcgtgtatcgatctctcgatctctctctctaagctccactcgaagtagggcattagcactaggggcctaagcagaggcttatcctcgctttagctcatattttcatcgcttgatgtgtcctctctgaacccccacatcttgtcttgtttggtttttccctctcccttccaatctatgtaaatttagctggtgtggtttggatcgagttgtgtcctctacagacaaccgaccgaccactactacctagaggaaattaatatcatcatgggtgtactgctccagctttaact</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0747900, RefSeq:Os02g0747900