Difference between revisions of "Os02g0765600"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
Alpha-amylase gene, RAmylA, encodes rice α-amylase isoform A.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
A significant difference in the seed germinability was observed between the two rice cultivars, 'Nipponbare' and 'Suweon 287', under anoxia (i.e., during germination in submerged soil at 18℃), although little difference was seen under aerobic (in air) or hypoxic (in water) conditions. The number of α-amylase isoforms synthesized in germinating seeds was inversely proportional to the O2 concentrations at the early germination stage. The formation of isoform B was promoted by oxygen supply, while isoform H was undetectable if the seeds were unable to germinate. The activity of isoform H was highly correlated with the coleoptile length in the submerged soil at 18℃, indicating that isoform H is a critical factor for seed germination under anoxia.  The expression of the rice α-amylase RAmy1A gene was repressed when the seeds germinated under hypoxia or anoxia.  
  
===Evolution===
+
===Ontology===
Please input evolution information here.
+
Gene ontology: The chemical reactions and pathways involve in carbohydrates.
 
+
----
You can also add sub-section(s) at will.
+
Growth stage ontology: It occurs when the seed coat has imbibed adequate water becoming soft and elastic.
  
 
==Labs working on this gene==
 
==Labs working on this gene==

Revision as of 11:32, 23 May 2014

Please input one-sentence summary here.

Annotated Information

Function

Alpha-amylase gene, RAmylA, encodes rice α-amylase isoform A.

Expression

A significant difference in the seed germinability was observed between the two rice cultivars, 'Nipponbare' and 'Suweon 287', under anoxia (i.e., during germination in submerged soil at 18℃), although little difference was seen under aerobic (in air) or hypoxic (in water) conditions. The number of α-amylase isoforms synthesized in germinating seeds was inversely proportional to the O2 concentrations at the early germination stage. The formation of isoform B was promoted by oxygen supply, while isoform H was undetectable if the seeds were unable to germinate. The activity of isoform H was highly correlated with the coleoptile length in the submerged soil at 18℃, indicating that isoform H is a critical factor for seed germination under anoxia. The expression of the rice α-amylase RAmy1A gene was repressed when the seeds germinated under hypoxia or anoxia.

Ontology

Gene ontology: The chemical reactions and pathways involve in carbohydrates.


Growth stage ontology: It occurs when the seed coat has imbibed adequate water becoming soft and elastic.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os02g0765600

Description

Alpha-amylase precursor (EC 3.2.1.1) (1,4-alpha-D-glucan glucanohydrolase) (Isozyme 1B)

Version

NM_001054755.1 GI:115448880 GeneID:4330832

Length

1846 bp

Definition

Oryza sativa Japonica Group Os02g0765600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:33135190..33137035

Sequence Coding Region

33135415..33135666,33135751..33136562,33136657..33136789,33136898..33137005

Expression

GEO Profiles:Os02g0765600

Genome Context

<gbrowseImage1> name=NC_008395:33135190..33137035 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:33135190..33137035 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgcaggtgctgaacaccatggtgaacaaacacttcttgtccctttcggtcctcatcgtcctccttggcctctcctccaacttgacagccgggcaagtcctgtttcagggattcaactgggagtcgtggaaggagaatggcgggtggtacaacttcctgatgggcaaggtggacgacatcgccgcagccggcatcacccacgtctggctccctccgccgtctcactctgtcggcgagcaaggctacatgcctgggcggctgtacgatctggacgcgtctaagtacggcaacgaggcgcagctcaagtcgctgatcgaggcgttccatggcaagggcgtccaggtgatcgccgacatcgtcatcaaccaccgcacggcggagcacaaggacggccgcggcatctactgcctcttcgagggcgggacgcccgactcccgcctcgactggggcccgcacatgatctgccgcgacgacccctacggcgatggcaccggcaacccggacaccggcgccgacttcgccgccgcgccggacatcgaccacctcaacaagcgcgtccagcgggagctcattggctggctcgactggctcaagatggacatcggcttcgacgcgtggcgcctcgacttcgccaagggctactccgccgacatggcaaagatctacatcgacgccaccgagccgagcttcgccgtggccgagatatggacgtccatggcgaacggcggggacggcaagccgaactacgaccagaacgcgcaccggcaggagctggtcaactgggtcgatcgtgtcggcggcgccaacagcaacgccacggcgttcgacttcaccaccaagggcatcctcaacgtcgccgtggagggcgagctgtggcgcctccgcggcgaggacggcaaggcgcccggcatgatcgggtggtggccggccaaggcgacgaccttcgtcgacaaccacgacaccggctcgacgcagcacctgtggccgttcccctccgacaaggtcatgcagggctacgcatacatcctcacccaccccggcaacccatgcatcttctacgaccatttcttcgattggggtctcaaggaggagatcgagcgcctggtgtcaatcagaaaccggcaggggatccacccggcgagcgagctgcgcatcatggaagctgacagcgatctctacctcgcggagatcgatggcaaggtgatcacaaagattggaccaagatacgacgtcgaacacctcatccccgaaggcttccaggtcgtcgcgcacggtgatggctacgcaatctgggagaaaatctga</cdnaseq>

Protein Sequence

<aaseq>MQVLNTMVNKHFLSLSVLIVLLGLSSNLTAGQVLFQGFNWESWK ENGGWYNFLMGKVDDIAAAGITHVWLPPPSHSVGEQGYMPGRLYDLDASKYGNEAQLK SLIEAFHGKGVQVIADIVINHRTAEHKDGRGIYCLFEGGTPDSRLDWGPHMICRDDPY GDGTGNPDTGADFAAAPDIDHLNKRVQRELIGWLDWLKMDIGFDAWRLDFAKGYSADM AKIYIDATEPSFAVAEIWTSMANGGDGKPNYDQNAHRQELVNWVDRVGGANSNATAFD FTTKGILNVAVEGELWRLRGEDGKAPGMIGWWPAKATTFVDNHDTGSTQHLWPFPSDK VMQGYAYILTHPGNPCIFYDHFFDWGLKEEIERLVSIRNRQGIHPASELRIMEADSDL YLAEIDGKVITKIGPRYDVEHLIPEGFQVVAHGDGYAIWEKI</aaseq>

Gene Sequence

<dnaseqindica>1370..1621#474..1285#247..379#31..138#aatcatccatctccgaagtgtgtctgcagcatgcaggtgctgaacaccatggtgaacaaacacttcttgtccctttcggtcctcatcgtcctccttggcctctcctccaacttgacagccgggcaagtcctgtttcaggtaagagatcgccatgagttgggtttcaggcttcagtgaactgatcgggttttgtactgagcctaagagaatgatgcagtgatgctcttgtgtttgatgatgatgcagggattcaactgggagtcgtggaaggagaatggcgggtggtacaacttcctgatgggcaaggtggacgacatcgccgcagccggcatcacccacgtctggctccctccgccgtctcactctgtcggcgagcaaggtgcggtgctctgctctctcgatcccctccgtcgtcgcaccattgccggcaaaatacatgcacaggtcgttgaattgcttgaatgcttctgcaggctacatgcctgggcggctgtacgatctggacgcgtctaagtacggcaacgaggcgcagctcaagtcgctgatcgaggcgttccatggcaagggcgtccaggtgatcgccgacatcgtcatcaaccaccgcacggcggagcacaaggacggccgcggcatctactgcctcttcgagggcgggacgcccgactcccgcctcgactggggcccgcacatgatctgccgcgacgacccctacggcgatggcaccggcaacccggacaccggcgccgacttcgccgccgcgccggacatcgaccacctcaacaagcgcgtccagcgggagctcattggctggctcgactggctcaagatggacatcggcttcgacgcgtggcgcctcgacttcgccaagggctactccgccgacatggcaaagatctacatcgacgccaccgagccgagcttcgccgtggccgagatatggacgtccatggcgaacggcggggacggcaagccgaactacgaccagaacgcgcaccggcaggagctggtcaactgggtcgatcgtgtcggcggcgccaacagcaacgccacggcgttcgacttcaccaccaagggcatcctcaacgtcgccgtggagggcgagctgtggcgcctccgcggcgaggacggcaaggcgcccggcatgatcgggtggtggccggccaaggcgacgaccttcgtcgacaaccacgacaccggctcgacgcagcacctgtggccgttcccctccgacaaggtcatgcagggctacgcatacatcctcacccaccccggcaacccatgcatcgtgagtagccaactcgatcagaaattctgaatcatcctgcaaactgatcgatgaactgatgataaattctgtaaaattgttcagttctacgaccatttcttcgattggggtctcaaggaggagatcgagcgcctggtgtcaatcagaaaccggcaggggatccacccggcgagcgagctgcgcatcatggaagctgacagcgatctctacctcgcggagatcgatggcaaggtgatcacaaagattggaccaagatacgacgtcgaacacctcatccccgaaggcttccaggtcgtcgcgcacggtgatggctacgcaatctgggagaaaatctgagcgcacgatgacgagactctcagtttagcagatttaacctgcgatttttaccctgaccggtatacgtatatacgtgccggcaacgagctgtatccgatccgaattacggatgcaattgtccacgaagtacttcctccgtaaataaagtgaggatcagggacatacatttgtatggttttacgaataatgctatgcaataaaatttgcactgcttaatgcttatgc</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0765600, RefSeq:Os02g0765600