Difference between revisions of "Os02g0814200"
| Line 1: | Line 1: | ||
| − | + | '''''OsGL1-6''''' is a member of the '''GL1-like genes''' in rice<ref name="ref1"/><ref name="ref2"/>. | |
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | + | ''OsGL1-6'' is involved in the '''accumulation of leaf cuticular wax''' and directly '''impacts drought resistance''' in rice. Genetic modification of ''OsGL1-6'' may have great potential for '''improving''' the '''drought resistance''' of rice<ref name="ref1"/>. | |
| + | |||
| + | |||
| + | '''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0003824 GO:0003824],[http://amigo.geneontology.org/amigo/term/GO:0008152 GO:0008152] | ||
| + | |||
| + | ===Mutation=== | ||
| + | Antisense-RNA Transgenic Plants<ref name="ref1"/>:<br> | ||
| + | These ''OsGL1-6'' antisense-RNA transgenic plants showed '''droopy leaves''' at the '''booting stage''', significantly '''decreased leaf cuticular wax deposition''', '''thinner cuticle membrane''', '''increased chlorophyll leaching''' and '''water loss rates''', and '''enhanced drought sensitivity'''. | ||
===Expression=== | ===Expression=== | ||
| − | + | *The ''OsGL1-6'' gene was constitutively expressed in all examined organs and was very '''highly''' expressed in '''leaf epidermal cells''' and '''vascular bundles'''. Analysis of the '''GUS activity''' showed that it was detected in the '''calli''', '''roots''', '''stems''', '''leaves''' and '''spikelets''' at '''different developmental stages'''. Although the expression of OsGL1-6 had '''tissue and developmental stage specificity''', most of it was localized in the '''epidermal cells''' and '''vascular bundle area'''<ref name="ref1"/>. | |
| + | |||
| + | *Qualitative and quantitative analysis of the wax composition using gas chromatography-mass spectrometry revealed a significantly reduced total cuticular wax load on the leaf blades of the ''OsGL1-6'' antisense-RNA transgenic plants as well as markedly decreased alkane and aldehyde contents. Their primary alcohol contents increased significantly compared with those in the wild type plants, suggesting that ''OsGL1-6'' is associated with the decarbonylation pathways in wax biosynthesis<ref name="ref1"/>. | ||
| + | |||
| + | *The OsGL1-6 gene showed high expression in '''germinating seeds''' (72 h after imbibitions) and '''shoot''' (seedling with two tillers)<ref name="ref2"/>. | ||
| + | |||
| + | *''OsGL1-6'' was '''induced by drought''', the ''OsGL1-6'' showed strong induction only at 2 day after treatment. ''OsGL1-6'' was '''induced by salt stress''' The expression level of ''OsGL1-6'' peaked at 6 h after treatment and then decreased. With '''cold treatment''', ''OsGL1-1'' and [[Os02g0621300|''OsGL1-4'']] showed strong induction at both 12 and 24 h after treatment, whereas ''OsGL1-6'' showed high expression at 12 h '''but dramatically decreased''' expression at 24 h<ref name="ref2"/>. | ||
| + | |||
| + | ===Subcellular localization=== | ||
| + | The transient expression of ''OsGL1-6''-GFP fusion indicated that ''OsGL1-6'' is localized in the '''endoplasmic reticulum (ER)'''<ref name="ref1"/>. | ||
===Evolution=== | ===Evolution=== | ||
| − | + | [[File: OsGL1-6 phylogenic1.jpg|right|thumb|250px|'''Figure 1.''' ''Scheme of the OsGL1-6 gene and phylogenic analysis of OsGL1-6-related proteins.(from reference <ref name="ref1"/>).'']] | |
| + | *''OsGL1-6'' is present on chromosome 2 of the rice genome and contains '''nine exons''' and '''eight introns''' (Figure 1A). The full length of ''OsGL1-6'' cDNA is 2,218 bp. The ORF of OsGL1-6 is 1,908 bp, and it encodes a protein with 635 amino acids that has a molecular mass of 71.6 kD and an isoelectric point of 8.64 and that belongs to the fatty aldehyde decarbonylase superfamily<ref name="ref1"/>. | ||
| + | |||
| + | *OsGL1-6 showed high sequence similarities with the identified numbers of the fatty aldehyde decarbonylase superfamily. OsGL1-6 has 53% sequence identity with CER1 and 33% homology with CER3/WAX2/YRE/FLP in ''Arabidopsis'', '''53%''' with Wda1, '''33%''' with OsGL1-1, and '''30%''' with OsGL1-2 in rice, and '''33%''' with GL1 in maize<ref name="ref1"/>. | ||
| + | |||
| + | *Phylogenic analysis of the '''predicted protein sequences''' for the '''six''' characterized genes with '''high similarities''' to OsGL1-6 showed that they can be grouped into '''two clades''' (Figure 1B). OsGL1-6 groups with WDA1 and CER1, whereas OsGL1-1, OsGL1-2, maize GL1, and WAX2 form the other group<ref name="ref1"/>. | ||
| − | + | ===Knowledge Extension=== | |
| + | The outermost surfaces of plants are covered with an epicuticular wax layer that provides a primary waterproof barrier and protection against different environmental stresses. '''Glossy 1''' (GL1) is one of the reported genes '''controlling wax synthesis'''<ref name="ref2"/>. | ||
==Labs working on this gene== | ==Labs working on this gene== | ||
| − | + | *Laboratory Center of Basic Biology and Biotechnology, Education Department of Guangdong Province, College of Life Sciences, Zhongkai University of Agriculture and Engineering, Guangzhou, Guangdong, People’s Republic of China | |
| + | *State Key Laboratory for Conservation and Utilization of Subtropical Agro-bioresources, College of Life Sciences, South China Agricultural University, Guangzhou, Guangdong, People’s Republic of China | ||
| + | *College of Agronomy, Northwest A&F University, Yangling, Shanxi, People’s Republic of China | ||
==References== | ==References== | ||
| − | + | <references> | |
| + | * <ref name="ref1"> | ||
| + | Zhou L, Ni E, Yang J, et al. Rice OsGL1-6 is involved in leaf cuticular wax accumulation and drought resistance[J]. PloS one, 2013, 8(5): e65139. | ||
| + | </ref> | ||
| + | * <ref name="ref2"> | ||
| + | Islam M A, Du H, Ning J, et al. Characterization of Glossy1-homologous genes in rice involved in leaf wax accumulation and drought resistance[J]. Plant molecular biology, 2009, 70(4): 443-456. | ||
| + | </ref> | ||
| + | </references> | ||
==Structured Information== | ==Structured Information== | ||
Revision as of 06:41, 1 March 2015
OsGL1-6 is a member of the GL1-like genes in rice[1][2].
Contents
Annotated Information
Function
OsGL1-6 is involved in the accumulation of leaf cuticular wax and directly impacts drought resistance in rice. Genetic modification of OsGL1-6 may have great potential for improving the drought resistance of rice[1].
GO assignment(s): GO:0003824,GO:0008152
Mutation
Antisense-RNA Transgenic Plants[1]:
These OsGL1-6 antisense-RNA transgenic plants showed droopy leaves at the booting stage, significantly decreased leaf cuticular wax deposition, thinner cuticle membrane, increased chlorophyll leaching and water loss rates, and enhanced drought sensitivity.
Expression
- The OsGL1-6 gene was constitutively expressed in all examined organs and was very highly expressed in leaf epidermal cells and vascular bundles. Analysis of the GUS activity showed that it was detected in the calli, roots, stems, leaves and spikelets at different developmental stages. Although the expression of OsGL1-6 had tissue and developmental stage specificity, most of it was localized in the epidermal cells and vascular bundle area[1].
- Qualitative and quantitative analysis of the wax composition using gas chromatography-mass spectrometry revealed a significantly reduced total cuticular wax load on the leaf blades of the OsGL1-6 antisense-RNA transgenic plants as well as markedly decreased alkane and aldehyde contents. Their primary alcohol contents increased significantly compared with those in the wild type plants, suggesting that OsGL1-6 is associated with the decarbonylation pathways in wax biosynthesis[1].
- The OsGL1-6 gene showed high expression in germinating seeds (72 h after imbibitions) and shoot (seedling with two tillers)[2].
- OsGL1-6 was induced by drought, the OsGL1-6 showed strong induction only at 2 day after treatment. OsGL1-6 was induced by salt stress The expression level of OsGL1-6 peaked at 6 h after treatment and then decreased. With cold treatment, OsGL1-1 and OsGL1-4 showed strong induction at both 12 and 24 h after treatment, whereas OsGL1-6 showed high expression at 12 h but dramatically decreased expression at 24 h[2].
Subcellular localization
The transient expression of OsGL1-6-GFP fusion indicated that OsGL1-6 is localized in the endoplasmic reticulum (ER)[1].
Evolution
- OsGL1-6 is present on chromosome 2 of the rice genome and contains nine exons and eight introns (Figure 1A). The full length of OsGL1-6 cDNA is 2,218 bp. The ORF of OsGL1-6 is 1,908 bp, and it encodes a protein with 635 amino acids that has a molecular mass of 71.6 kD and an isoelectric point of 8.64 and that belongs to the fatty aldehyde decarbonylase superfamily[1].
- OsGL1-6 showed high sequence similarities with the identified numbers of the fatty aldehyde decarbonylase superfamily. OsGL1-6 has 53% sequence identity with CER1 and 33% homology with CER3/WAX2/YRE/FLP in Arabidopsis, 53% with Wda1, 33% with OsGL1-1, and 30% with OsGL1-2 in rice, and 33% with GL1 in maize[1].
- Phylogenic analysis of the predicted protein sequences for the six characterized genes with high similarities to OsGL1-6 showed that they can be grouped into two clades (Figure 1B). OsGL1-6 groups with WDA1 and CER1, whereas OsGL1-1, OsGL1-2, maize GL1, and WAX2 form the other group[1].
Knowledge Extension
The outermost surfaces of plants are covered with an epicuticular wax layer that provides a primary waterproof barrier and protection against different environmental stresses. Glossy 1 (GL1) is one of the reported genes controlling wax synthesis[2].
Labs working on this gene
- Laboratory Center of Basic Biology and Biotechnology, Education Department of Guangdong Province, College of Life Sciences, Zhongkai University of Agriculture and Engineering, Guangzhou, Guangdong, People’s Republic of China
- State Key Laboratory for Conservation and Utilization of Subtropical Agro-bioresources, College of Life Sciences, South China Agricultural University, Guangzhou, Guangdong, People’s Republic of China
- College of Agronomy, Northwest A&F University, Yangling, Shanxi, People’s Republic of China
References
- ↑ 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 1.9 Zhou L, Ni E, Yang J, et al. Rice OsGL1-6 is involved in leaf cuticular wax accumulation and drought resistance[J]. PloS one, 2013, 8(5): e65139.
- ↑ 2.0 2.1 2.2 2.3 Islam M A, Du H, Ning J, et al. Characterization of Glossy1-homologous genes in rice involved in leaf wax accumulation and drought resistance[J]. Plant molecular biology, 2009, 70(4): 443-456.
Structured Information
| Gene Name |
Os02g0814200 |
|---|---|
| Description |
Similar to CER1-like gene protein (Fragment) |
| Version |
NM_001055025.1 GI:115449536 GeneID:4331117 |
| Length |
4199 bp |
| Definition |
Oryza sativa Japonica Group Os02g0814200, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 2:35776536..35780734 |
| Sequence Coding Region |
35776750..35776950,35777032..35777205,35777607..35777705,35777812..35778012,35778597..35778704 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008395:35776536..35780734 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008395:35776536..35780734 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcctctaagccagggcctctcactcagtggccgtggcataaccttggaaactacaagtacgcgctggtggcgccgtcggcggcgtacagcacgtacaggttcgtgacggcgagcagcgcggcggagcgagacctcctcaacttcatggtgttccccatgctgctcctccgtctgctctacggccagctctggatcaccgtctcccgccaccagactgcccggagcaagcacaagatcgtcaacaagagcctcgacttcgaacaaatcgacagggaaagaaactgggatgaccagataatcctgacggcgctggtgttctacttggtgagcgcgacgatgccgcaggcgcaggtggcaccgtggtggagcacaaaggggatggtggtgacggcggtgctgcacgcggggccagtggagttcctctactactggctgcacagggcgctgcaccaccactggctgtacgcgcggtaccactcgcaccaccacgcctccatcgtcactgagcccatcacctccgtcatccaccccttcgccgaggaggtcgtctacttcgtcctcctcgccatccccatcctcagcaccgtcgccaccggcaccgtctctgtcgtcacggccaacggctacctcgtctacatcgacttcatgaactacctcggccactgcaacttcgagctcgtccccaagtgcctcttccacgtcttcccccctctcaaatatctcctctacaccccatcgtttcattcgttgcaccacacgcagttcaggacgaactactcgctgttcatgccggtgtacgactacatctacgggacgacggacaagtcaagcgacgagctgtacgagaggacgctgcaggggagggacgaggcggcgtggcggccggacgtggtgcacctcacgcacctcaccacgccggagtccgtcttccacaaccgcctcggcttcgccgccgtcgcgtccaacccgcttggcgccgcagcctccggccacctcctccgtgccgcctccgccgtcgcctcccctctcctctccctcttcgcctccaccttcaggtcggaggccaaccgcctcgacaagctcaacatcgagacctgggtcatcccaaggttcacctcccactatacgtcgaagagtgatgggtacaaggtcagccgtttgatagagaaagcggtgtcagacgcagaagcaagtggcgcgagagtcctcacgctcggcctcctcaaccaggggtacgatctgaacaggaacggggagttatatgtcgtcaggaagccaagcctgaagacgaagatcgtcgatggaacaagcctcgctgttgctgccgttctcaacatgatccctcagggcaccaaagatgtgctcctcctgggaaacgcgaacaagatctctctcgttcttaccctgtccctctgcaagcgggagatccaggtgaggatggtaaataaggagctgtatgaatgcctgaagcagcagctgcagcctgaaatgcaggagcatctggttttgtcatgcagttacagcagcaaggtgtggctcgtgggcgacggggtgacggatgaggagcagatgaaagcccagaaaggatcccatttcgtgccgtactcgcagttccctcccaacaaggcccgcaacgactgcgtctaccactgcaccccggctctactcgtccctgaatccttcgaaaaccttcacgtttgcgagaattggttgccgaggagggtgatgagcgcgtggcgggcggcggggatcgttcacgcgctggagaagtgggacgggcacgagtgcggcggcagggtcaccggcgtgcagaaggcgtggagcgcggcgctggcacggggattccggccatacgacgaccaccaccaccccggcatcacccatgatggccgtggcgggctgtga</cdnaseq> |
| Protein Sequence |
<aaseq>MASKPGPLTQWPWHNLGNYKYALVAPSAAYSTYRFVTASSAAER DLLNFMVFPMLLLRLLYGQLWITVSRHQTARSKHKIVNKSLDFEQIDRERNWDDQIIL TALVFYLVSATMPQAQVAPWWSTKGMVVTAVLHAGPVEFLYYWLHRALHHHWLYARYH SHHHASIVTEPITSVIHPFAEEVVYFVLLAIPILSTVATGTVSVVTANGYLVYIDFMN YLGHCNFELVPKCLFHVFPPLKYLLYTPSFHSLHHTQFRTNYSLFMPVYDYIYGTTDK SSDELYERTLQGRDEAAWRPDVVHLTHLTTPESVFHNRLGFAAVASNPLGAAASGHLL RAASAVASPLLSLFASTFRSEANRLDKLNIETWVIPRFTSHYTSKSDGYKVSRLIEKA VSDAEASGARVLTLGLLNQGYDLNRNGELYVVRKPSLKTKIVDGTSLAVAAVLNMIPQ GTKDVLLLGNANKISLVLTLSLCKREIQVRMVNKELYECLKQQLQPEMQEHLVLSCSY SSKVWLVGDGVTDEEQMKAQKGSHFVPYSQFPPNKARNDCVYHCTPALLVPESFENLH VCENWLPRRVMSAWRAAGIVHALEKWDGHECGGRVTGVQKAWSAALARGFRPYDDHHH PGITHDGRGGL</aaseq> |
| Gene Sequence |
<dnaseqindica>3785..3985#3530..3703#3030..3128#2723..2923#2031..2138#1485..1869#783..1235#273..499#97..156#acagccatctcctctctactgtcaatctcaagtgcgtgcccggtatcagctcgaccggtctcgcacctgcaaccaaaccacacacagctagctatcatggcctctaagccagggcctctcactcagtggccgtggcataaccttggaaactacaaggtactaaattatgttttatcgtcatcatcagatttgatttgatgccatacgttgtttgtaagctgattgcaacaatgtgagtaattaacgactgttgcgtacgtggaaatctacagtacgcgctggtggcgccgtcggcggcgtacagcacgtacaggttcgtgacggcgagcagcgcggcggagcgagacctcctcaacttcatggtgttccccatgctgctcctccgtctgctctacggccagctctggatcaccgtctcccgccaccagactgcccggagcaagcacaagatcgtcaacaagagcctcgacttcgaacaaatcgacagggaaagaaactggtaattaatcgatcaaattgagtgtacgtctaagggactgtttagtcggtgaaatgaaaatttcgggtgttacatcttttgagattttgcttcagtctagcgaaaagtaccttaaggtaacggtatatcacagtactaaatcgtttttgttcgttgaatcaaactggacaggatggacaatattagatccaatcatcagaaacgacacctcgagatacttttcgttagactagagcatatctctaagttttttgggttttcatatttacatatatggatgcagggatgaccagataatcctgacggcgctggtgttctacttggtgagcgcgacgatgccgcaggcgcaggtggcaccgtggtggagcacaaaggggatggtggtgacggcggtgctgcacgcggggccagtggagttcctctactactggctgcacagggcgctgcaccaccactggctgtacgcgcggtaccactcgcaccaccacgcctccatcgtcactgagcccatcacctccgtcatccaccccttcgccgaggaggtcgtctacttcgtcctcctcgccatccccatcctcagcaccgtcgccaccggcaccgtctctgtcgtcacggccaacggctacctcgtctacatcgacttcatgaactacctcggccactgcaacttcgagctcgtccccaagtgcctcttccacgtcttcccccctctcaaatatctcctctacaccccatcgtacgtataaatttacctgtttaaaaatataccattacaatttaacgggattgctatttagcgcaatgttggttattttagtacacctttttttctttctgaaaactttcattcaaaaaacttatattggagaacttttacatgaaaatactttatatgaaaaagtgtacagtgagaaatatgagtaataattaattatactaattaactgctaatagagatcattaattagtgtatgtatgtatgtaggtttcattcgttgcaccacacgcagttcaggacgaactactcgctgttcatgccggtgtacgactacatctacgggacgacggacaagtcaagcgacgagctgtacgagaggacgctgcaggggagggacgaggcggcgtggcggccggacgtggtgcacctcacgcacctcaccacgccggagtccgtcttccacaaccgcctcggcttcgccgccgtcgcgtccaacccgcttggcgccgcagcctccggccacctcctccgtgccgcctccgccgtcgcctcccctctcctctccctcttcgcctccaccttcaggtcggaggccaaccgcctcgacaagctcaacatcgagacctgggtcatcccaaggttcacctcccacgtacgtaattttgactaatttttaaatacaaaatatactcatacaaaatctccatttctttaagtatttttttctcgtacaaaatatacgtatagtttggaatgtttgtttttgtgtatgaggaaatagtgaattaattgcgtgcattgatggaatcgcagtatacgtcgaagagtgatgggtacaaggtcagccgtttgatagagaaagcggtgtcagacgcagaagcaagtggcgcgagagtcctcacgctcggcctcctcaaccaggtaaatgcattcgctgacccacctgacagatccaattcattgcatgccttctcactgttcgccggctttaatgtaacagtaccagcagtaggtgcaacttcgtagcatcactctttcctctctgcactagctccccaagtagttacatgggaccgaattcacctaccaagatttacaaaatttattaggctgtgtttagattcaaacttccaactttttccatcacattaacctgtcgtatatatataatttttcagtcatattgtaccaattttaactcaaactttcaactttagaaagaactaaacacagccttactagcatcagacagtataagaatttttttttcatgtttctcaaaatatatctggacatcagttgaaaacgtgcataaatgcttatacaccattttggaatggatggagtaataaatttcagcagccagaggttcatatgacagtggcactttttacttcaagaaaaaggaacagtgtttagcaaatgttcgccccataaatctgctttggtcctgcacgggtatatgtcaggcgatgctaattaaatcgatccaattgtacgtgcaggggtacgatctgaacaggaacggggagttatatgtcgtcaggaagccaagcctgaagacgaagatcgtcgatggaacaagcctcgctgttgctgccgttctcaacatgatccctcagggcaccaaagatgtgctcctcctgggaaacgcgaacaagatctctctcgttcttaccctgtccctctgcaagcgggagatccaggtataataccaaaatgacagtactcgaccagttaatattcttaacagtatcgatcacggtgattaaaaaggttactggctgtaactaatttcgaacaaaaaaacaggtgaggatggtaaataaggagctgtatgaatgcctgaagcagcagctgcagcctgaaatgcaggagcatctggttttgtcatgcagttacagcagcaaggtaattgaaaattggctctgtttggatccgaagggctattaaatagcccttcaggattttgctatttaagagtattaaacgtagattactgacaaaactcattccataactcctaggctattttgcgagacgaatctaacgagatatattaatccatgatttgctacagtaatgctacagtaatcagccgctaattatggattaatatatatcattagattcgtctcacaaaataggctaagggttatagaatcggttttgtcgataatctacgtttaataatcctaaatagcaagatttcagagcgctatttaatagtccgaaggatccaaacagggtcattgtgggtaactggacgttgtggcgtggatgaaataaatcgaaactgcgtgcgtatgcaggtgtggctcgtgggcgacggggtgacggatgaggagcagatgaaagcccagaaaggatcccatttcgtgccgtactcgcagttccctcccaacaaggcccgcaacgactgcgtctaccactgcaccccggctctactcgtccctgaatccttcgaaaaccttcacgtttgcgaggtactccctctgtaccacttacttcgtccgtctcagaatatagttatctttagctatgaatctgaacacatatgcacgcagaattggttgccgaggagggtgatgagcgcgtggcgggcggcggggatcgttcacgcgctggagaagtgggacgggcacgagtgcggcggcagggtcaccggcgtgcagaaggcgtggagcgcggcgctggcacggggattccggccatacgacgaccaccaccaccccggcatcacccatgatggccgtggcgggctgtgaccggccggtggccggatcgaagcaacctggcctgattgtgtgatcttgtgtgtgcttcttcgctcggttgatatataggagtatctccgtgtgtgttatgatggggccagattaatatccagctataaaatcccaagctgtattgttaattctctgccggtgtcataatctattgtttgagcataacttaaatttgagcatgattaatttggag</dnaseqindica> |
| External Link(s) |
