Difference between revisions of "Os05g0584200"
Qingxiangmu (talk | contribs) (→Expression) |
|||
| Line 7: | Line 7: | ||
===Expression=== | ===Expression=== | ||
Please input expression information here. | Please input expression information here. | ||
| + | In order to well understand the function of this protein, the expression pattern of OsLEA5 in rice was analyzed. Realtime PCR analysis showed that OsLEA5 transcript was detected in the roots and leaves of rice plant at the seedling stage, their roots, stems, and leaves at the tillering stage, and their roots, stems, leaves, and panicles at the heading stage, filling stage, and full ripe stage, which demonstrated OsLEA5 can express in different tissue organs during different development stages of rice (Fig. 5). However,significant differences were observed. The expression of OsLEA5 in leaves at all times kept at a relatively higher level during the different development stages of rice. In both roots and panicles of full ripe stage, the expression levels of OsLEA5 were dramatically upregulated, which were about 17-fold and 15-fold higher than those in leaves, respectively (Fig. 5). These results illustrated that OsLEA5 might cope with various environmental stresses,maturation, and desiccation phases of rice seed development. | ||
===Evolution=== | ===Evolution=== | ||
Revision as of 08:47, 13 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here. In order to well understand the function of this protein, the expression pattern of OsLEA5 in rice was analyzed. Realtime PCR analysis showed that OsLEA5 transcript was detected in the roots and leaves of rice plant at the seedling stage, their roots, stems, and leaves at the tillering stage, and their roots, stems, leaves, and panicles at the heading stage, filling stage, and full ripe stage, which demonstrated OsLEA5 can express in different tissue organs during different development stages of rice (Fig. 5). However,significant differences were observed. The expression of OsLEA5 in leaves at all times kept at a relatively higher level during the different development stages of rice. In both roots and panicles of full ripe stage, the expression levels of OsLEA5 were dramatically upregulated, which were about 17-fold and 15-fold higher than those in leaves, respectively (Fig. 5). These results illustrated that OsLEA5 might cope with various environmental stresses,maturation, and desiccation phases of rice seed development.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os05g0584200 |
|---|---|
| Description |
Similar to Late embryogenesis abundant protein Lea14-A |
| Version |
NM_001062984.1 GI:115465698 GeneID:4339745 |
| Length |
1237 bp |
| Definition |
Oryza sativa Japonica Group Os05g0584200, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 5:29070275..29071511 |
| Sequence Coding Region |
29070755..29070960,29071073..29071322 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008398:29070275..29071511 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008398:29070275..29071511 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgtcgagcttgatggacaaggcgaaagggttcgtggcggagaagatcgcgcacatcccaaagccggaggcgtcgctggacagcttgtcgttcaaggggatgagccgcgagtgcatcaccgtgcacagcaacgtcaacgtctccaacccctacgaccaccgcctccccatctgcgagctcacctacaccctcaagtgcgccggcaacgttgtggcgtccggcacgatgcccgatccggggtggatcgcggcgagcgacacgacgaagctggagataccggccaagatcccctacgacttcctcatctcgctggtgaaggacgtgggccgggactgggacatcgactaccagctcgacgtcggcctcaccatcgacctccccatcgtcggcaacttcaccatcccgctctccaccagcggcgagatgaagctccccacactcaaggacatgttctaa</cdnaseq> |
| Protein Sequence |
<aaseq>MSSLMDKAKGFVAEKIAHIPKPEASLDSLSFKGMSRECITVHSN VNVSNPYDHRLPICELTYTLKCAGNVVASGTMPDPGWIAASDTTKLEIPAKIPYDFLI SLVKDVGRDWDIDYQLDVGLTIDLPIVGNFTIPLSTSGEMKLPTLKDMF</aaseq> |
| Gene Sequence |
<dnaseqindica>481..686#799..1048#agtgcagagatgggatcgccgatcagtgagcgattcggtgcaggcaactgataaggagggaggatctctccgccgactcagcaccgtccgtttcgggacgtggtgccgttttggccccgcgccgaagcttctcccctttgcagttatcaaattccccttgcagccacgcagatttacgccgcgcccccacgcaacccaaaagttcagcgtaaacttgcctatcaacaaaactacagctcaggcggccacgcgaaatcgcgaggtttcacgtaccaaaagcgcaaaaatccactcggattccacgcggccgagccactgcacgtgggcgcccacgacgcgcccccgtatcgatcggcaccgcgctttcctcctcctgatcttacccgctactatatcatcatctgcttgctttccccccgagagtccacggcctcctgctcctctcgatccaagataatttcactccagcgtgcgtcggccatgtcgagcttgatggacaaggcgaaagggttcgtggcggagaagatcgcgcacatcccaaagccggaggcgtcgctggacagcttgtcgttcaaggggatgagccgcgagtgcatcaccgtgcacagcaacgtcaacgtctccaacccctacgaccaccgcctccccatctgcgagctcacctacaccctcaagtgcgccggcaagtacgtgtcacagctagcttttgcttgtccgatcgatgatccatccatctcacgctcgatcgaattgtgctaattgtgtattggtcgatttggattgattggtcatcatcagcgttgtggcgtccggcacgatgcccgatccggggtggatcgcggcgagcgacacgacgaagctggagataccggccaagatcccctacgacttcctcatctcgctggtgaaggacgtgggccgggactgggacatcgactaccagctcgacgtcggcctcaccatcgacctccccatcgtcggcaacttcaccatcccgctctccaccagcggcgagatgaagctccccacactcaaggacatgttctaattatcttatctctaatctcatcaaccaactccgatcgatcgaactctctgtatgtgtgatgtgtctcgcgaataatggcagctgctctgcacctgtgttcttcttgccctgcatagtatagcatggctgtatgagcggctgaaaaattacctctattcctaatggttgcaataataagctagagaactg</dnaseqindica> |
| External Link(s) |
