Difference between revisions of "Os07g0258400"
| Line 1: | Line 1: | ||
| − | + | The rice ''OsNRAMP1'' gene is well known as the "iron transporter gene" and plays a role in Cd & Fe uptake and accumulation in rice. | |
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | + | [[File:Cuiya01.PNG|right|thumb|400px|''Schematic view of transverse section of the transgenic root. (from reference <ref name="ref4" />).'']] | |
| + | |||
| + | ''OsNRAMP1'' gene localized to the plasma membrane and transported Cd as well as Fe. It plays a role in Fe uptake and/or translocation from roots to the aerial parts, including rice grains. OsNRAMP1 may also participate in Cd uptake and/or transport throughout the rice plant <ref name="ref1" />. | ||
| + | Expression of OsNRAMP1 in yeast mutant (fet3fet4) rescued iron (Fe) uptake and exhibited enhanced accumulation of As and Cd. Expression of OsNRAMP1 in Arabidopsis provided tolerance with enhanced As and Cd accumulation in root and shoot. Cellular localization revealed that OsNRAMP1 resides on plasma membrane of endodermis and pericycle cells and may assist in xylem loading for root to shoot mobilization. This is the first report demonstrating role of NRAMP in xylem mediated loading and enhanced accumulation of As and Cd in plants <ref name="ref4" />. | ||
| + | |||
| + | '''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0016020 GO:0016020] | ||
===Expression=== | ===Expression=== | ||
| − | + | The expression of OsNRAMP1 has been observed mainly in the roots at the vegetative stage <ref name="ref2" />. A search of the microarray database RiceXPro16 (http://ricexpro.dna.affrc.go.jp/) revealed that steady-state expression of OsNRAMP1 is observed in the whole plant, i.e., the leaf blade, root, stem, anther, ovary, embryo, endosperm and pistil. In the leaf blade and stem, OsNRAMP1 expression is higher during the reproductive stage <ref name="ref1" />. | |
| + | Expression studies in normal plant tissues indicate that while OsNramp1 is expressed primarily in roots, and OsNramp2 is primarily expressed in leaves, OsNramp3 is expressed in both tissues<ref name="ref3" />. | ||
===Evolution=== | ===Evolution=== | ||
| − | + | OsNramp1, OsNramp2, and OsNramp3 encode a novel group of highly similar hydrophobic polypeptides sharing between 64% and 75% sequence similarity, that show similar hydropathy profiles, and predicted secondary structure, including the same number, position, and sequence characteristics (including conserved charges) of transmembrane domains. Together, these define a highly conserved membrane associated hydrophobic core. The three plant proteins show a remarkable degree of sequence similarity with their mammalian counterpart (60% to 70% similarity), including primary and secondary structure elements previously described in ion transporters and channels. The recent discovery that the yeast Nramp homologue SMF1 functions as a manganese transporter raises the exciting possibility that OsNramp encodes a family of metal ion transporters in plants<ref name="ref3" />. | |
| + | The amino acid sequence of OsNRAMP1 in the Sasanishiki and Habataki cultivars was found to be 100% identical<ref name="ref2" />. | ||
| + | |||
| + | === Knowledge Extension === | ||
| + | The NRAMP (natural resistance-associated macrophage proteins) family of metal transporters has been identified in several plant species, and many of the NRAMP family proteins function as Fe transporters<ref name="ref1" />. In Arabidopsis, AtNRAMP1, AtNRAMP3 and AtNRAMP4 have been reported to be Fe transporters and also mediate Cd transport. Rice possesses seven putative NRAMP genes. Microarray analysis revealed that only one of these, OsNRAMP1, together with OsIRT1 and OsIRT2, is highly upregulated by Fe deficiency(Table1, the induction ratio was calculated as the increased or decreased expression level after Fe deficiency for 1 week compared with expression under normal conditions (-Fe/+Fe).) <ref name="ref1" />. | ||
| − | + | {| class='wikitable' style="text-align:center" | |
| + | |- | ||
| + | ! | Accession number | ||
| + | ! | Gene name | ||
| + | ! | Roots | ||
| + | ! | Shoots | ||
| + | |- | ||
| + | | | Os07g0258400 | ||
| + | | | OsNRAMP1 | ||
| + | | | 15.1 | ||
| + | | | 290.2 | ||
| + | |- | ||
| + | | | Os03g0208500 | ||
| + | | | OsNRAMP2 | ||
| + | | | 1.3 | ||
| + | | | 0.9 | ||
| + | |- | ||
| + | | | Os06g0676000 | ||
| + | | | OsNRAMP3 | ||
| + | | | 1.0 | ||
| + | | | 1.1 | ||
| + | |- | ||
| + | | | Os02g0131800 | ||
| + | | | OsNRAMP4 | ||
| + | | | 0.6 | ||
| + | | | 0.7 | ||
| + | |- | ||
| + | | | Os07g0257200 | ||
| + | | | OsNRAMP5 | ||
| + | | | 1.9 | ||
| + | | | 0.8 | ||
| + | |- | ||
| + | | | Os01g0503400 | ||
| + | | | OsNRAMP6 | ||
| + | | | 1.1 | ||
| + | | | 1.0 | ||
| + | |- | ||
| + | | | Os12g0581600 | ||
| + | | | OsNRAMP7 | ||
| + | | | 0.7 | ||
| + | | | 1.1 | ||
| + | |} | ||
==Labs working on this gene== | ==Labs working on this gene== | ||
| − | + | *Graduate School of Agricultural and Life Sciences; University of Tokyo; Tokyo, Japan | |
| + | *Research Institute for Bioresources and Biotechnology; Ishikawa Prefectural University; Ishikawa, Japan | ||
| + | *National Institute for Agro-Environmental Sciences, 3-1-3 Kannondai, Tsukuba, Ibaraki 305-8604, Japan | ||
| + | *Department of Biochemistry, McGill University, Montreal Quebec, Canada | ||
| + | *CSIR-National Botanical Research Institute (CSIR-NBRI), Rana Pratap Marg, Lucknow 226001, India | ||
| + | *Department of Botany, University of Lucknow, Lucknow 226007, India | ||
==References== | ==References== | ||
| − | + | <references> | |
| + | <ref name="ref4">Abdelmajid B, Tony K and Philippe G. (2014) Expression in Arabidopsis and cellular localization reveal involvement of rice NRAMP, OsNRAMP1, in arsenic transport and toleranc. Plant, Cell and Environment 37: 140-152</ref> | ||
| + | <ref name="ref1">Takahashi R, Ishimaru Y, Nakanishi H, et al. (2011) Role of the iron transporter OsNRAMP1 in cadmium uptake and accumulation in rice. Plant Signal Behav 6:1813-1816.</ref> | ||
| + | <ref name="ref2">Takahashi R, Ishimaru Y, Senoura T, et al. (2011) The OsNRAMP1 iron transporter is involved in Cd accumulation in rice. J Exp Bot 62:4843-4850.</ref> | ||
| + | <ref name="ref3">Abdelmajid B, Tony K and Philippe G. (1997) Cloning and characterization of the OsNramp family from Oryza sativa, a new family of membrane proteins possibly implicated in the transport of metal ions. Plant Molecular Biology 33: 1085-1092.</ref> | ||
| + | </references> | ||
==Structured Information== | ==Structured Information== | ||
Revision as of 04:38, 29 May 2014
The rice OsNRAMP1 gene is well known as the "iron transporter gene" and plays a role in Cd & Fe uptake and accumulation in rice.
Contents
Annotated Information
Function
OsNRAMP1 gene localized to the plasma membrane and transported Cd as well as Fe. It plays a role in Fe uptake and/or translocation from roots to the aerial parts, including rice grains. OsNRAMP1 may also participate in Cd uptake and/or transport throughout the rice plant [2]. Expression of OsNRAMP1 in yeast mutant (fet3fet4) rescued iron (Fe) uptake and exhibited enhanced accumulation of As and Cd. Expression of OsNRAMP1 in Arabidopsis provided tolerance with enhanced As and Cd accumulation in root and shoot. Cellular localization revealed that OsNRAMP1 resides on plasma membrane of endodermis and pericycle cells and may assist in xylem loading for root to shoot mobilization. This is the first report demonstrating role of NRAMP in xylem mediated loading and enhanced accumulation of As and Cd in plants [1].
GO assignment(s): GO:0016020
Expression
The expression of OsNRAMP1 has been observed mainly in the roots at the vegetative stage [3]. A search of the microarray database RiceXPro16 (http://ricexpro.dna.affrc.go.jp/) revealed that steady-state expression of OsNRAMP1 is observed in the whole plant, i.e., the leaf blade, root, stem, anther, ovary, embryo, endosperm and pistil. In the leaf blade and stem, OsNRAMP1 expression is higher during the reproductive stage [2]. Expression studies in normal plant tissues indicate that while OsNramp1 is expressed primarily in roots, and OsNramp2 is primarily expressed in leaves, OsNramp3 is expressed in both tissues[4].
Evolution
OsNramp1, OsNramp2, and OsNramp3 encode a novel group of highly similar hydrophobic polypeptides sharing between 64% and 75% sequence similarity, that show similar hydropathy profiles, and predicted secondary structure, including the same number, position, and sequence characteristics (including conserved charges) of transmembrane domains. Together, these define a highly conserved membrane associated hydrophobic core. The three plant proteins show a remarkable degree of sequence similarity with their mammalian counterpart (60% to 70% similarity), including primary and secondary structure elements previously described in ion transporters and channels. The recent discovery that the yeast Nramp homologue SMF1 functions as a manganese transporter raises the exciting possibility that OsNramp encodes a family of metal ion transporters in plants[4]. The amino acid sequence of OsNRAMP1 in the Sasanishiki and Habataki cultivars was found to be 100% identical[3].
Knowledge Extension
The NRAMP (natural resistance-associated macrophage proteins) family of metal transporters has been identified in several plant species, and many of the NRAMP family proteins function as Fe transporters[2]. In Arabidopsis, AtNRAMP1, AtNRAMP3 and AtNRAMP4 have been reported to be Fe transporters and also mediate Cd transport. Rice possesses seven putative NRAMP genes. Microarray analysis revealed that only one of these, OsNRAMP1, together with OsIRT1 and OsIRT2, is highly upregulated by Fe deficiency(Table1, the induction ratio was calculated as the increased or decreased expression level after Fe deficiency for 1 week compared with expression under normal conditions (-Fe/+Fe).) [2].
| Accession number | Gene name | Roots | Shoots |
|---|---|---|---|
| Os07g0258400 | OsNRAMP1 | 15.1 | 290.2 |
| Os03g0208500 | OsNRAMP2 | 1.3 | 0.9 |
| Os06g0676000 | OsNRAMP3 | 1.0 | 1.1 |
| Os02g0131800 | OsNRAMP4 | 0.6 | 0.7 |
| Os07g0257200 | OsNRAMP5 | 1.9 | 0.8 |
| Os01g0503400 | OsNRAMP6 | 1.1 | 1.0 |
| Os12g0581600 | OsNRAMP7 | 0.7 | 1.1 |
Labs working on this gene
- Graduate School of Agricultural and Life Sciences; University of Tokyo; Tokyo, Japan
- Research Institute for Bioresources and Biotechnology; Ishikawa Prefectural University; Ishikawa, Japan
- National Institute for Agro-Environmental Sciences, 3-1-3 Kannondai, Tsukuba, Ibaraki 305-8604, Japan
- Department of Biochemistry, McGill University, Montreal Quebec, Canada
- CSIR-National Botanical Research Institute (CSIR-NBRI), Rana Pratap Marg, Lucknow 226001, India
- Department of Botany, University of Lucknow, Lucknow 226007, India
References
- ↑ 1.0 1.1 Abdelmajid B, Tony K and Philippe G. (2014) Expression in Arabidopsis and cellular localization reveal involvement of rice NRAMP, OsNRAMP1, in arsenic transport and toleranc. Plant, Cell and Environment 37: 140-152
- ↑ 2.0 2.1 2.2 2.3 Takahashi R, Ishimaru Y, Nakanishi H, et al. (2011) Role of the iron transporter OsNRAMP1 in cadmium uptake and accumulation in rice. Plant Signal Behav 6:1813-1816.
- ↑ 3.0 3.1 Takahashi R, Ishimaru Y, Senoura T, et al. (2011) The OsNRAMP1 iron transporter is involved in Cd accumulation in rice. J Exp Bot 62:4843-4850.
- ↑ 4.0 4.1 Abdelmajid B, Tony K and Philippe G. (1997) Cloning and characterization of the OsNramp family from Oryza sativa, a new family of membrane proteins possibly implicated in the transport of metal ions. Plant Molecular Biology 33: 1085-1092.
Structured Information
| Gene Name |
Os07g0258400 |
|---|---|
| Description |
OsNramp1 (Integral membrane protein) |
| Version |
NM_001065850.1 GI:115471432 GeneID:4342862 |
| Length |
4772 bp |
| Definition |
Oryza sativa Japonica Group Os07g0258400, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 7:8998211..9002982 |
| Sequence Coding Region |
8998266..8998349,8999394..8999472,8999542..8999582,8999714..8999792,8999874..8999978 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008400:8998211..9002982 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008400:8998211..9002982 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgggggtgacgaaggcggaggcggttgccggcgacggcgggaaggtggtggacgacatcgaggcgctcgccgatctcagaaaggagccagcatggaaaaggtttttgtcccacattggaccaggctttatggtctgtttggcttacctcgatcctggaaatatggagactgatctacaagctggtgccaatcacaaatatgagcttctttgggtgattttgattggcctgatctttgcactgattatacaatcattatcggctaatcttggagtggtgacagggcgccatcttgctgagctgtgcaagactgaatatccagtatgggtgaaaacctgcttatggctgctagcagaactagctgtgattgcttccgatattccagaagttataggtacaggatttgctttcaaccttttgttccacataccagtgtggaccggggttctcattgctggctctagcacgcttcttcttcttggactgcaaagatatggggtaaggaaactggaggttgtggtcgcgctattggtgtttgtcatggcagggtgcttcttcgtggagatgagcatagtcaagcctccggttaatgaggtccttcaaggattattcatccccaggctcagtgggcccggtgccacaggagactccattgcccttcttggggctcttgtaatgccgcacaatctattcttgcactctgccctggtgctgtcgaggaatacacccgcatcagcaaaaggaatgaaggatgtctgtaggttcttcctctttgagagtgggatagctcttttcgtggctctgcttgtcaacattgcaatcatctctgtctccggcactgtatgtaatgcaaccaacctttcaccagaagatgctgtaaaatgcagcgaccttacattggactcctcatccttcctcctcaggaatgtgctaggaaagtcaagtgcgacagtgtacggtgtagcactcttggcttctggacagagctcgaccattactggcacttatgctgggcaatatgttatgcaggggttcctagacatcaaaatgaaacagtggcttcggaacctgatgacacgcagcattgccattgtgcctagcttaatcgtctccatcattggagggtctagtggcgccggtcgtctcatcgtcattgcatcgatgattctatcctttgagctaccatttgctctgatccctcttctcaagttcagcagcagcagcaacaagatgggtgaaaacaagaactccatctatattgttggattctcctgggtgctggggttcgtcatcatcgggataaacatctacttcctcagcacaaagctggtcggctggatcctccacaacgcgctcccgacattcgccaacgtgctcatcggcatcgtgctgttcccgctcatgctgctctacgtcgtcgccgtgatctacctgacgttcaggaaggacaccgtcaagttcgtgtctcgtcgtgagctgcaggccggcgacgacaccgagaaagcacaggtagccacctgcgtcgccgacgagcacagcaaagagccacccgtgtag</cdnaseq> |
| Protein Sequence |
<aaseq>MGVTKAEAVAGDGGKVVDDIEALADLRKEPAWKRFLSHIGPGFM VCLAYLDPGNMETDLQAGANHKYELLWVILIGLIFALIIQSLSANLGVVTGRHLAELC KTEYPVWVKTCLWLLAELAVIASDIPEVIGTGFAFNLLFHIPVWTGVLIAGSSTLLLL GLQRYGVRKLEVVVALLVFVMAGCFFVEMSIVKPPVNEVLQGLFIPRLSGPGATGDSI ALLGALVMPHNLFLHSALVLSRNTPASAKGMKDVCRFFLFESGIALFVALLVNIAIIS VSGTVCNATNLSPEDAVKCSDLTLDSSSFLLRNVLGKSSATVYGVALLASGQSSTITG TYAGQYVMQGFLDIKMKQWLRNLMTRSIAIVPSLIVSIIGGSSGAGRLIVIASMILSF ELPFALIPLLKFSSSSNKMGENKNSIYIVGFSWVLGFVIIGINIYFLSTKLVGWILHN ALPTFANVLIGIVLFPLMLLYVVAVIYLTFRKDTVKFVSRRELQAGDDTEKAQVATCV ADEHSKEPPV</aaseq> |
| Gene Sequence |
<dnaseqindica>56..139#1184..1262#1332..1372#1504..1582#1664..1768#2009..2118#2300..2481#2699..2768#2856..3029#3163..3267#3474..3605#3852..3947#4063..4362#agttgttgagaggcaaggcaaactcaggcgactgagctaaagaagccgcactagtatgggggtgacgaaggcggaggcggttgccggcgacggcgggaaggtggtggacgacatcgaggcgctcgccgatctcagaaaggttaattctctctgcaaatactcctggttgctcatacttaaatctacctatgaatgagggatcgcatcgatgtcgcagttggagttggacggacaggagtgagaaattattatctctgatctgattcctgttggtatgcactcttgctgtttgtgaaaatgccccagaggatgcatccacaggacacggcgccttcaatatttataagttgattcaatgatgggtttctttcatgtttctttgctgaaaaatcgtgtttagtagagtagtcttctatgtctctattcaaaagaaaagtggcattaagttataggagaaaataaaagggagaagtcgttttgttaattaggagcttctcctttcgataactatgacttaatagttcatttttattatggaacaaagatgagatacaaaacaatagattgtgatcacctcagtttttttgtttgatatcaagtctgacaaactaaggcattacggttctctgctcttgtttgacaaacgaagtctattgtacaatagaagtctgttgtttaatgtctctacttttggtcatctcttgtatggtttagcctagatctcagtttatcttactataggtcgccgatagtacaatatgatttgtttctccgccgtacctaatccaaaatcatatagcttgacattatctgcttcgcatagatgttcgttataagcttcaaattacaaatttcatattgaaagtttagcctcttcttgttggactataatagcgagtccatgtgaacatcatttcttacattaatatacatttcttcacatttgtggctagttattttacttgccctaccattgtcgcatttatttatatttccataactcattttccaatgcttagttgaatgtatcattcactcattcttgtattgtttgtacgtctttgagactttgactgaaaatagtcttagttttgtacctattttatattttgctttatgttttaattattttctttgacatgatgtgcatgcatatttattactaattggtcatgtaacacaggagccagcatggaaaaggtttttgtcccacattggaccaggctttatggtctgtttggcttacctcgatcctggaaatagtaatattctctctctaaatttattttctcacactcatatggtttctcacgcttgacgaattgaaacagtggagactgatctacaagctggtgccaatcacaaatatgaggtacattctctagccttttctatatgacttttcctgccatttatcacagttgtcatgtcttttgttacagcgagaagaaagaaacaattaactgatatgcttcttgatgtgctctttcatatgtttcttagcttctttgggtgattttgattggcctgatctttgcactgattatacaatcattatcggctaatcttggagtggtgacaggtaataaatagacactttcagcacacaattgatttaacatttcagttggaagtagcaagtaatgaatgtcaattgatacagggcgccatcttgctgagctgtgcaagactgaatatccagtatgggtgaaaacctgcttatggctgctagcagaactagctgtgattgcttccgatattccagaaggttggaaatagaatgatagatctaaataaaaaaaagttaatgtttaactgtcacctttgagtttcagttgattaagtttataaactctctcactgatataagtgtacgagcaacacttgcactgattgtatacagtctcttatccactaaacattatgatatgtagcactttttctgagaagaaagcaacaacatctaatctaatatttggtgttttttacacatgtaccttttgtgcagttataggtacaggatttgctttcaaccttttgttccacataccagtgtggaccggggttctcattgctggctctagcacgcttcttcttcttggactgcaaagatatggggtaaccaactatttatgactggatatatgatagatgtctgtataaaatgttttaatgaatgtctaaacatcattgtattgtatttgatcattactgtttggtcattgtaaatggtggtcattacaaatgggtttgttgttgaattgacttgtttgcatttttccttcatctatataactaggtaaggaaactggaggttgtggtcgcgctattggtgtttgtcatggcagggtgcttcttcgtggagatgagcatagtcaagcctccggttaatgaggtccttcaaggattattcatccccaggctcagtgggcccggtgccacaggagactccattgcccttcttggggctcttgtaatgccgtaagcagtcaaacatgcatatatacccccagttgttaatgtgtgcaatgtcttttttgcgtcttaagattcttctagggtagctgtaaacatgcataaggttttcaactctccagtaattacaaatctccacaatggtagttttagtctttttttagattttgacaaaatgcactcttgttaatcataagtgagcattatcagttattaattacaggcacaatctattcttgcactctgccctggtgctgtcgaggaatacacccgcatcagcaaaaggaatgaaggtgatcagatgtccgtgttcttgcattaaaaaagaaatggtactcctagttggctgatacatattccttcattcttttgtactccaggatgtctgtaggttcttcctctttgagagtgggatagctcttttcgtggctctgcttgtcaacattgcaatcatctctgtctccggcactgtatgtaatgcaaccaacctttcaccagaagatgctgtaaaatgcagcgaccttacattggactcctcatccttcctcctcagggtactgcatatatgtgcaaagttcatcaccatttatatttagttgtgttattttcttcacaaaaataaattagtcatgttatcattgaccatataatggtcatttacagaattattatttatttttttttcagaatgtgctaggaaagtcaagtgcgacagtgtacggtgtagcactcttggcttctggacagagctcgaccattactggcacttatgctgggcaatatgttatgcaggtatattttacctgaactctaaccttgtttacaaattaaccaagtactatctgtgaactattttcttaatgaccagttcaagtggtatagtattaaccacgcagtaaactagaagatctccaaaatggtgaaagaaatgaaaaaaagtttgcaatctatcaagcttgaatgtatagtaacagttttttttttccatgtatctacaggggttcctagacatcaaaatgaaacagtggcttcggaacctgatgacacgcagcattgccattgtgcctagcttaatcgtctccatcattggagggtctagtggcgccggtcgtctcatcgtcattgcatcggtacaatcttttactacaaatgaaaatatcagtttgcccataagaacactcattaaaaaaaactgccatacaatcaaccatcttctaattttctcaataattagtaagttatttgctaatcgaaatgcttctttcttcaaaaaatggacggtatgtaatttgttgtacctcattccttctgatcatactgttaaaaagaatcaaaacctaatgcttgttttggtttggctgttacgtttcatacagatgattctatcctttgagctaccatttgctctgatccctcttctcaagttcagcagcagcagcaacaagatgggtgaaaacaagaactccatctatgtaagcactcccccatcaatcaatcaatccttctttctagcttgtccacacatagaaaacaaaaacaaaaaaaatcctggaaaactaataatgcattggtaattaaaacctgcagattgttggattctcctgggtgctggggttcgtcatcatcgggataaacatctacttcctcagcacaaagctggtcggctggatcctccacaacgcgctcccgacattcgccaacgtgctcatcggcatcgtgctgttcccgctcatgctgctctacgtcgtcgccgtgatctacctgacgttcaggaaggacaccgtcaagttcgtgtctcgtcgtgagctgcaggccggcgacgacaccgagaaagcacaggtagccacctgcgtcgccgacgagcacagcaaagagccacccgtgtagtacccttccagaccggttaccggtgttggctggtttttattggatagatgtttaggtccaattttttttatataaaaaatccaatagatgtttaggtccaaatttttgaattcaaaaaccggttagcagtgataaccggctgaaattttggcccatgggagtagattgttgctttttttcttagtgattagttattggcagattggcagaatgttgtagctaggcaatctaattgtatggttagatatttagtcataaatccaagagtgagttttcttggatgcgaggacaaggacaatctaattgtatggttagatatttagtcataaatccaagagtgagttttcttggatgcgaggacaaggacaaatataaatgtaaataaatgcagttaaagtaacaccttgctc</dnaseqindica> |
| External Link(s) |