Difference between revisions of "Os07g0492000"
| Line 1: | Line 1: | ||
| − | + | Nucleoside diphosphate kinase (NDK) is a ubiquitous enzyme found in all organisms and cell types, and catalyzes the transfer of the phosphoryl group from a nucleoside triphosphate to a nucleoside diphosphate. | |
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | + | 1. Crystal structure of nucleoside diphosphate kinase required for coleoptile elongation in rice | |
| + | 2. OsNDPK1 expression in rice plants is enhanced upon infection with bacterial pathogens | ||
===Expression=== | ===Expression=== | ||
| − | + | Transcripts of OsNDPK1 accumulated strongly after infection with Xoo. When rice plants were infected with Burkholderia glumae, a bacterial grain/seedling rot pathogen, the pattern of expression of the rice NDPK genes was similar to that following infection with Xoo. OsNDPK1 gene expression was also strongly induced in response to exposure to salicylic acid, jasmonic acid, and abscisic acid, although the level of transcripts and their pattern of expression depended on the inducer. | |
===Evolution=== | ===Evolution=== | ||
| − | + | When OsNDPK1 was aligned with other rice NDPK isoforms, it proved to be moderately similar to the conserved regions of NP922751 (76% identity), OsNDPK2 (67% identity), and OsNDPK3 (55% identity). | |
You can also add sub-section(s) at will. | You can also add sub-section(s) at will. | ||
==Labs working on this gene== | ==Labs working on this gene== | ||
| − | + | Agricultural Plant Stress Research Center, Applied Plant Science Division, College of Agriculture and Life Sciences, Chonnam | |
| + | National University, Gwangju 500-757, Korea; | ||
==References== | ==References== | ||
| − | + | 1. Huang J Y, Chang T, Chang C Y, et al. Crystal structure of nucleoside diphosphate kinase required for coleoptile elongation in rice (< i> Oryza sativa</i> L.)[J]. Journal of structural biology, 2005, 150(3): 309-318. | |
| + | 2. Cho S M, Shin S H, Kim K S, et al. Enhanced expression of a gene encoding a nucleoside diphosphate kinase 1 (OsNDPK1) in rice plants upon infection with bacterial pathogens[J]. Mol Cells, 2004, 18(3): 390-395. | ||
| + | |||
==Structured Information== | ==Structured Information== | ||
Revision as of 15:35, 9 June 2014
Nucleoside diphosphate kinase (NDK) is a ubiquitous enzyme found in all organisms and cell types, and catalyzes the transfer of the phosphoryl group from a nucleoside triphosphate to a nucleoside diphosphate.
Contents
Annotated Information
Function
1. Crystal structure of nucleoside diphosphate kinase required for coleoptile elongation in rice 2. OsNDPK1 expression in rice plants is enhanced upon infection with bacterial pathogens
Expression
Transcripts of OsNDPK1 accumulated strongly after infection with Xoo. When rice plants were infected with Burkholderia glumae, a bacterial grain/seedling rot pathogen, the pattern of expression of the rice NDPK genes was similar to that following infection with Xoo. OsNDPK1 gene expression was also strongly induced in response to exposure to salicylic acid, jasmonic acid, and abscisic acid, although the level of transcripts and their pattern of expression depended on the inducer.
Evolution
When OsNDPK1 was aligned with other rice NDPK isoforms, it proved to be moderately similar to the conserved regions of NP922751 (76% identity), OsNDPK2 (67% identity), and OsNDPK3 (55% identity).
You can also add sub-section(s) at will.
Labs working on this gene
Agricultural Plant Stress Research Center, Applied Plant Science Division, College of Agriculture and Life Sciences, Chonnam National University, Gwangju 500-757, Korea;
References
1. Huang J Y, Chang T, Chang C Y, et al. Crystal structure of nucleoside diphosphate kinase required for coleoptile elongation in rice (< i> Oryza sativa</i> L.)[J]. Journal of structural biology, 2005, 150(3): 309-318. 2. Cho S M, Shin S H, Kim K S, et al. Enhanced expression of a gene encoding a nucleoside diphosphate kinase 1 (OsNDPK1) in rice plants upon infection with bacterial pathogens[J]. Mol Cells, 2004, 18(3): 390-395.
Structured Information
| Gene Name |
Os07g0492000 |
|---|---|
| Description |
Nucleoside diphosphate kinase I (EC 2.7.4.6) (NDK I) (NDP kinase I) (NDPK I) |
| Version |
NM_001066217.1 GI:115472166 GeneID:4343275 |
| Length |
2484 bp |
| Definition |
Oryza sativa Japonica Group Os07g0492000, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 7:18995155..18997638 |
| Sequence Coding Region |
18995452..18995569,18996011..18996242,18997223..18997271,18997470..18997520 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008400:18995155..18997638 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008400:18995155..18997638 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggagcagtccttcatcatgatcaagcctgacggcgtccagagaggcctgattggagacatcatcagcaggttcgagaagaaaggattctacctgagggggatgaagttcatgaatgtggagaggtcctttgcacagcagcactatgccgacctttccgacaagcccttcttccctgggttggtggagtacatcatctctggccccgtcgttgcgatggtttgggaagggaaggatgttgttgccactggccgcaggatcattggggccaccaggccctgggaggcagcccccggcaccatccgtgctgactatgccgtggaagttggcaggaatgtcatccatgggagcgactccgtggacaacgggaagaaggagatcgctctctggttccctgaaggtttagctgagtggaggagcaaccttcacccttggatctatgagtcttag</cdnaseq> |
| Protein Sequence |
<aaseq>MEQSFIMIKPDGVQRGLIGDIISRFEKKGFYLRGMKFMNVERSF AQQHYADLSDKPFFPGLVEYIISGPVVAMVWEGKDVVATGRRIIGATRPWEAAPGTIR ADYAVEVGRNVIHGSDSVDNGKKEIALWFPEGLAEWRSNLHPWIYES</aaseq> |
| Gene Sequence |
<dnaseqindica>2070..2187#1397..1628#368..416#119..169#actccgcctcgcctccactcctctcctctccgcatcctcctcatcgcctccgcttctgcttttttttttcttttttctcgttgatcggtttgttcgatcagatcggttctttggagagatggagcagtccttcatcatgatcaagcctgacggcgtccagagaggcctggtaatctgacttctttttttcttttaatgttcttcttgtcgttttggccatcgattttcgagaggaattttgcggtttcggatcggttaaatagcgtagttgattggtgtttgtttgtgagattttgagttgttttggtaactttttgtaccgttttgcgtggtttttaatggggaattttgattttctgttctgcagattggagacatcatcagcaggttcgagaagaaaggattctacctgaggggtatggctgatccttttcccctctcgatttgatcgtatggattcatttttcataactttcttttgtatttttattgatctaattttgggttgacctacccgtttttttcaacacatattatgaaaagcagaggctgacgatatcataatactctgtttcatatgggtaggttggggttgtgagttgtgacatggagaatttgatgggtttaatacatgattcaaaagcaagatttttttatataatttatatgttgatgattggccatttttaactggggacaacagactgacacagtaatattcaatttagtatatcaactgattcgttgtcaagtctaattttgcattacatgacatgggcaacttatttattattatagcagagatcgtcaaagcctcaaagatgtagtctactatttgtacttgtaatcatggaaatatctttctgaaaagaaaacatcatttgtacttgcaatagagttcaactaatatctttggcatgcatttaacgtgctcttttccattttttgttccttattaaaagttgttgtactttagtggaaaccaaaatgttttataaagcattacagaacaacaaaaacagctgtcttaaggaacagcaacaaagaacagaagtaaaggactttcatttaacttcccctgtttataacaactgtgtagccatgtattggttgatgtggcgattataacaactgtgaagcccatttttatgagaattattcgaaatgcacgcaaaacatcatccaaaaacttaatttcatttaacttcccctgtttaagaaatatacttcctccattccaaactataagcatttatgcgtgttattcacaatgaatctcgatcttgagattcattctgaaaaacaagtataaatgctttttattttggaacggaggtaatattcggttgagggatgatggtgcttacgaattactttttgaactgcaatgatccagggatgaagttcatgaatgtggagaggtcctttgcacagcagcactatgccgacctttccgacaagcccttcttccctgggttggtggagtacatcatctctggccccgtcgttgcgatggtttgggaagggaaggatgttgttgccactggccgcaggatcattggggccaccaggccctgggaggcagcccccggcaccatccgtgctgactatgccgtggaagttggcaggtgagtcattcttgtctgtcttggtcatcagctcattattgcttgaattttcagtcagttcttgtgatccttttaatcatgtaaggatcctgagcgatggatggttctttatttgttttgctgctagcatcaaacgatgattttgtttgaaaatgggtggttaagtggcttttattttgatctatataaatgtgtgaacctctgttttttaccagtcagaaggtatcagatagtgaatgtgctgtgatatgatttacaaaaacttttgcatgcattatgatgttcatcttttctatatgttacgatgttagtgtatttagacataataactacttggattatgttaaactatgttcaattctagcttttgtttttgaaaataaaaatcataatgcttcctgcttatcgatgcctaagctcaagctgttgtttcttgtgtaggaatgtcatccatgggagcgactccgtggacaacgggaagaaggagatcgctctctggttccctgaaggtttagctgagtggaggagcaaccttcacccttggatctatgagtcttagagcttcgcgcctataatcgatcacctcttggtggctagttctcgttaaatatttgagttttgtttcagagttgtcatctggctgcctcctgagtcaccattataattctgctgtgatacaatcacagttatatgttgcctgaacttatatggctttttaagtttctggattggatgtgatgggaaaataatactagcagtcagtttttgcttataaatgtcgtaatatcttaatcatgctctttccctaggttcatccaagataagcagatggtgttgcctgattttcttgtggcac</dnaseqindica> |
| External Link(s) |