Difference between revisions of "Os07g0492000"

From RiceWiki
Jump to: navigation, search
Line 1: Line 1:
Please input one-sentence summary here.
+
Nucleoside diphosphate kinase (NDK) is a ubiquitous enzyme found in all organisms and cell types, and catalyzes the transfer of the phosphoryl group from a nucleoside triphosphate to a nucleoside diphosphate.  
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
1. Crystal structure of nucleoside diphosphate kinase required for coleoptile elongation in rice
 +
2. OsNDPK1 expression in rice plants is enhanced upon infection with bacterial pathogens
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
Transcripts of OsNDPK1 accumulated strongly after infection with Xoo. When rice plants were infected with Burkholderia glumae, a bacterial grain/seedling rot pathogen, the pattern of expression of the rice NDPK genes was similar to that following infection with Xoo. OsNDPK1 gene expression was also strongly induced in response to exposure to salicylic acid, jasmonic acid, and abscisic acid, although the level of transcripts and their pattern of expression depended on the inducer.
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
When OsNDPK1 was aligned with other rice NDPK isoforms, it proved to be moderately similar to the conserved regions of NP922751 (76% identity), OsNDPK2 (67% identity), and OsNDPK3 (55% identity).
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
Agricultural Plant Stress Research Center, Applied Plant Science Division, College of Agriculture and Life Sciences, Chonnam
 +
National University, Gwangju 500-757, Korea;
  
 
==References==
 
==References==
Please input cited references here.
+
1. Huang J Y, Chang T, Chang C Y, et al. Crystal structure of nucleoside diphosphate kinase required for coleoptile elongation in rice (< i> Oryza sativa</i> L.)[J]. Journal of structural biology, 2005, 150(3): 309-318.
 +
2. Cho S M, Shin S H, Kim K S, et al. Enhanced expression of a gene encoding a nucleoside diphosphate kinase 1 (OsNDPK1) in rice plants upon infection with bacterial pathogens[J]. Mol Cells, 2004, 18(3): 390-395.
 +
 
  
 
==Structured Information==
 
==Structured Information==

Revision as of 15:35, 9 June 2014

Nucleoside diphosphate kinase (NDK) is a ubiquitous enzyme found in all organisms and cell types, and catalyzes the transfer of the phosphoryl group from a nucleoside triphosphate to a nucleoside diphosphate.

Annotated Information

Function

1. Crystal structure of nucleoside diphosphate kinase required for coleoptile elongation in rice 2. OsNDPK1 expression in rice plants is enhanced upon infection with bacterial pathogens

Expression

Transcripts of OsNDPK1 accumulated strongly after infection with Xoo. When rice plants were infected with Burkholderia glumae, a bacterial grain/seedling rot pathogen, the pattern of expression of the rice NDPK genes was similar to that following infection with Xoo. OsNDPK1 gene expression was also strongly induced in response to exposure to salicylic acid, jasmonic acid, and abscisic acid, although the level of transcripts and their pattern of expression depended on the inducer.

Evolution

When OsNDPK1 was aligned with other rice NDPK isoforms, it proved to be moderately similar to the conserved regions of NP922751 (76% identity), OsNDPK2 (67% identity), and OsNDPK3 (55% identity).

You can also add sub-section(s) at will.

Labs working on this gene

Agricultural Plant Stress Research Center, Applied Plant Science Division, College of Agriculture and Life Sciences, Chonnam National University, Gwangju 500-757, Korea;

References

1. Huang J Y, Chang T, Chang C Y, et al. Crystal structure of nucleoside diphosphate kinase required for coleoptile elongation in rice (< i> Oryza sativa</i> L.)[J]. Journal of structural biology, 2005, 150(3): 309-318. 2. Cho S M, Shin S H, Kim K S, et al. Enhanced expression of a gene encoding a nucleoside diphosphate kinase 1 (OsNDPK1) in rice plants upon infection with bacterial pathogens[J]. Mol Cells, 2004, 18(3): 390-395.


Structured Information

Gene Name

Os07g0492000

Description

Nucleoside diphosphate kinase I (EC 2.7.4.6) (NDK I) (NDP kinase I) (NDPK I)

Version

NM_001066217.1 GI:115472166 GeneID:4343275

Length

2484 bp

Definition

Oryza sativa Japonica Group Os07g0492000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 7

Location

Chromosome 7:18995155..18997638

Sequence Coding Region

18995452..18995569,18996011..18996242,18997223..18997271,18997470..18997520

Expression

GEO Profiles:Os07g0492000

Genome Context

<gbrowseImage1> name=NC_008400:18995155..18997638 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008400:18995155..18997638 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggagcagtccttcatcatgatcaagcctgacggcgtccagagaggcctgattggagacatcatcagcaggttcgagaagaaaggattctacctgagggggatgaagttcatgaatgtggagaggtcctttgcacagcagcactatgccgacctttccgacaagcccttcttccctgggttggtggagtacatcatctctggccccgtcgttgcgatggtttgggaagggaaggatgttgttgccactggccgcaggatcattggggccaccaggccctgggaggcagcccccggcaccatccgtgctgactatgccgtggaagttggcaggaatgtcatccatgggagcgactccgtggacaacgggaagaaggagatcgctctctggttccctgaaggtttagctgagtggaggagcaaccttcacccttggatctatgagtcttag</cdnaseq>

Protein Sequence

<aaseq>MEQSFIMIKPDGVQRGLIGDIISRFEKKGFYLRGMKFMNVERSF AQQHYADLSDKPFFPGLVEYIISGPVVAMVWEGKDVVATGRRIIGATRPWEAAPGTIR ADYAVEVGRNVIHGSDSVDNGKKEIALWFPEGLAEWRSNLHPWIYES</aaseq>

Gene Sequence

<dnaseqindica>2070..2187#1397..1628#368..416#119..169#actccgcctcgcctccactcctctcctctccgcatcctcctcatcgcctccgcttctgcttttttttttcttttttctcgttgatcggtttgttcgatcagatcggttctttggagagatggagcagtccttcatcatgatcaagcctgacggcgtccagagaggcctggtaatctgacttctttttttcttttaatgttcttcttgtcgttttggccatcgattttcgagaggaattttgcggtttcggatcggttaaatagcgtagttgattggtgtttgtttgtgagattttgagttgttttggtaactttttgtaccgttttgcgtggtttttaatggggaattttgattttctgttctgcagattggagacatcatcagcaggttcgagaagaaaggattctacctgaggggtatggctgatccttttcccctctcgatttgatcgtatggattcatttttcataactttcttttgtatttttattgatctaattttgggttgacctacccgtttttttcaacacatattatgaaaagcagaggctgacgatatcataatactctgtttcatatgggtaggttggggttgtgagttgtgacatggagaatttgatgggtttaatacatgattcaaaagcaagatttttttatataatttatatgttgatgattggccatttttaactggggacaacagactgacacagtaatattcaatttagtatatcaactgattcgttgtcaagtctaattttgcattacatgacatgggcaacttatttattattatagcagagatcgtcaaagcctcaaagatgtagtctactatttgtacttgtaatcatggaaatatctttctgaaaagaaaacatcatttgtacttgcaatagagttcaactaatatctttggcatgcatttaacgtgctcttttccattttttgttccttattaaaagttgttgtactttagtggaaaccaaaatgttttataaagcattacagaacaacaaaaacagctgtcttaaggaacagcaacaaagaacagaagtaaaggactttcatttaacttcccctgtttataacaactgtgtagccatgtattggttgatgtggcgattataacaactgtgaagcccatttttatgagaattattcgaaatgcacgcaaaacatcatccaaaaacttaatttcatttaacttcccctgtttaagaaatatacttcctccattccaaactataagcatttatgcgtgttattcacaatgaatctcgatcttgagattcattctgaaaaacaagtataaatgctttttattttggaacggaggtaatattcggttgagggatgatggtgcttacgaattactttttgaactgcaatgatccagggatgaagttcatgaatgtggagaggtcctttgcacagcagcactatgccgacctttccgacaagcccttcttccctgggttggtggagtacatcatctctggccccgtcgttgcgatggtttgggaagggaaggatgttgttgccactggccgcaggatcattggggccaccaggccctgggaggcagcccccggcaccatccgtgctgactatgccgtggaagttggcaggtgagtcattcttgtctgtcttggtcatcagctcattattgcttgaattttcagtcagttcttgtgatccttttaatcatgtaaggatcctgagcgatggatggttctttatttgttttgctgctagcatcaaacgatgattttgtttgaaaatgggtggttaagtggcttttattttgatctatataaatgtgtgaacctctgttttttaccagtcagaaggtatcagatagtgaatgtgctgtgatatgatttacaaaaacttttgcatgcattatgatgttcatcttttctatatgttacgatgttagtgtatttagacataataactacttggattatgttaaactatgttcaattctagcttttgtttttgaaaataaaaatcataatgcttcctgcttatcgatgcctaagctcaagctgttgtttcttgtgtaggaatgtcatccatgggagcgactccgtggacaacgggaagaaggagatcgctctctggttccctgaaggtttagctgagtggaggagcaaccttcacccttggatctatgagtcttagagcttcgcgcctataatcgatcacctcttggtggctagttctcgttaaatatttgagttttgtttcagagttgtcatctggctgcctcctgagtcaccattataattctgctgtgatacaatcacagttatatgttgcctgaacttatatggctttttaagtttctggattggatgtgatgggaaaataatactagcagtcagtttttgcttataaatgtcgtaatatcttaatcatgctctttccctaggttcatccaagataagcagatggtgttgcctgattttcttgtggcac</dnaseqindica>

External Link(s)

NCBI Gene:Os07g0492000, RefSeq:Os07g0492000