Difference between revisions of "Os09g0417600"

From RiceWiki
Jump to: navigation, search
Line 1: Line 1:
−
Please input one-sentence summary here.
+
The transcription factor '''''OsWRKY76''''', is a member of rice group IIa WRKY<ref name="ref1"/><ref name="ref2"/><ref name="ref3"/>.
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
−
Please input function information here.
+
*OsWRKY76 '''encodes a group IIa WRKY transcription factor''' of rice. OsWRKY76 plays '''dual and opposing roles''' in '''blast disease resistance''' and '''cold tolerance'''. OsWRKY76 '''binds specifically to the W-box element'''. OsWRKY76 acts as a transcriptional repressor via binding to the W-box<ref name="ref1"/>. 
 +
 
 +
 
 +
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0003700 GO:0003700],[http://amigo.geneontology.org/amigo/term/GO:0005634 GO:0005634], [http://amigo.geneontology.org/amigo/term/GO:0043565 GO:0043565], GO:0045449
 +
 
 +
===Mutation===
 +
Transgenic plants<ref name="ref1"/>:
 +
*Transgenic plants showed '''more severe symptoms''', which often blasted the whole plant, compared with non-transformed control (NT) plants both in the '''excised leaves''' and in the intact plants.
 +
*Observations of cross-sections of the inoculated leaf blades revealed that in NT plants, the '''spread of mycelia''' was generally '''limited to the spaces''' between motor cells and vascular tissues at 4 dai.
 +
*In W76-OX plants, however, the mycelia vigorously spread into parenchymatous tissues in addition to motor cells and vascular tissues, '''causing a collapse of the parenchyma''', and hyphae already spread over the leaf surface at 4 dai
 +
*These results indicate that the constitutive overexpression of OsWRKY76 '''suppresses basal resistance to ''M. oryzae''''' to a large extent.
  
 
===Expression===
 
===Expression===
−
Please input expression information here.
+
*The expression of OsWRKY76 was induced within 48 h after inoculation with rice blast fungus (Magnaporthe oryzae), and by '''wounding''', '''low temperature''', '''benzothiadiazole''', and '''abscisic acid'''<ref name="ref1"/>.
 +
 
 +
*OsWRKY76 showed '''sequence-specific DNA binding''' to the W-box element in vitro and exhibited W-box-mediated transcriptional repressor activity in cultured rice cells. Overexpression of OsWRKY76 in rice plants resulted in '''drastically increased susceptibility to M. oryzae''', but '''improved tolerance to cold stress'''. Microarray analysis revealed that overexpression of OsWRKY76 '''suppresses the induction''' of a specific set of PR genes and of genes involved in phytoalexin synthesis '''after inoculation with blast fungus''', consistent with the observation that the levels of phytoalexins in the transgenic rice plants remained significantly lower than those in non-transformed control plants<ref name="ref1"/>.
 +
 
 +
*Overexpression of OsWRKY76 led to the '''increased expression of abiotic stress-associated genes''' such as '''peroxidase''' and '''lipid metabolism genes'''. Overexpression of OsWRKY76 '''increases susceptibility to the blast fungus''' in rice and confers cold tolerance to rice via protection of membranes from damage<ref name="ref1"/>.
 +
 
 +
===Subcellular localization===
 +
Green fluorescent protein-fused OsWRKY76 '''localized to the nuclei''' in rice epidermal cells, which means OsWRKY76 protein is '''targeted to the nucleus'''<ref name="ref1"/>.
  
 
===Evolution===
 
===Evolution===
−
Please input evolution information here.
+
[[File:OsWRKYs Phylogenetic1.jpg|right|thumb|300px|'''Figure 1.''' Phylogenetic tree of M.grisea-inducible OsWRKYs constructed using the neighbor-joining method.(from reference <ref name="ref2"/>).'']] 
 +
*The sequence analysis for 15 ''M. grisea''-inducible ''OsWRKYs'' indicated that 5, ''OsWRKY30'', ''OsWRKY70'', ''OsWRKY82'', ''OsWRKY84'', and ''OsWRKY85'', belong to '''WRKY group I''' which contains two WRKY domains(Fig. 2)<ref name="ref2"/>。 Among the '''WRKY group IIc family''', four ''M. grisea''-inducible WRKYs were identified, ''OsWRKY7'', ''OsWRKY10'', ''OsWRKY11'', and ''OsWRKY67''(Fig. 1). The remaining ''M. grisea''-inducible WRKYs were included in four different groups: ''''''IIa'''''' (''OsWRKY62'' and ''OsWRKY76''), '''IIb''' (''OsWRKY32''), '''IId''' (''OsWRKY83''), and '''III''' (''OsWRKY45'' and ''OsWRKY64'') (Fig. 1)<ref name="ref2"/><ref name="ref3"/>.
 +
 
 +
===Knowledge Extension===
 +
[[File: WRKY-smRNA interactome1.jpg|right|thumb|300px|'''Figure 2.''' ''Modeling the WRKY-smRNA interactome during reprogramming of defense responses.(from reference <ref name="ref4"/>).'']]
 +
 
 +
*The WRKY TF superfamily consists of 74 and 109 members in ''Arabidopsis'' (''Arabidopsis thaliana'') and rice (''Oryza sativa''), respectively<ref name="ref4"/><ref name="ref5"/><ref name="ref6"/>.
 +
 
 +
*The current data point toward the existence of a WRKY-smRNA interactome, where on the one hand, pathogen attack triggers the expression of WRKY genes that regulate cellular smRNA populations, and on the other hand, several differentially regulated smRNAs modulateWRKY TF levels by targeting their transcripts (Fig. 2)<ref name="ref4"/>.
  
−
You can also add sub-section(s) at will.
+
*During pathogen attack, smRNA-generating loci may be under the control of WRKY TFs; at the same time, WRKY abundance may be regulated by smRNAs. RdR, RNA-directed RNA polymerase(Fig. 2)<ref name="ref4"/>.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
−
Please input related labs here.
+
*Disease Resistant Crops Research Unit, GMO Research Center, National Institute of Agrobiological Sciences, 2-1-2 Kannondai,
 +
Tsukuba, Ibaraki 305-8602, Japan
 +
*Biotechnology Research Center, The University of Tokyo, 1-1-1 Yayoi, Bunkyo-ku, Tokyo 113-8657, Japan
 +
*Department of Biosciences, Teikyo University, 1-1 Toyosatodai, Utsunomiya, Tochigi 320-8551, Japan
 +
*Sakata Seed Corporation, Kimitsu Research Station, 358 Uchikoshi, Sodegaura, Chiba 299-0217, Japan
  
 
==References==
 
==References==
−
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Yokotani N, Sato Y, Tanabe S, et al. WRKY76 is a rice transcriptional repressor playing opposite roles in blast disease resistance and cold stress tolerance[J]. Journal of experimental botany, 2013, 64(16): 5085-5097.
 +
</ref>
 +
* <ref name="ref2">
 +
Ryu H S, Han M, Lee S K, et al. A comprehensive expression analysis of the WRKY gene superfamily in rice plants during defense response[J]. Plant cell reports, 2006, 25(8): 836-847.
 +
</ref>
 +
* <ref name="ref3">
 +
Peng Y, Bartley L E, Canlas P, et al. OsWRKY IIa transcription factors modulate rice innate immunity[J]. Rice, 2010, 3(1): 36-42.
 +
</ref>
 +
* <ref name="ref4">
 +
Pandey S P, Somssich I E. The role of WRKY transcription factors in plant immunity[J]. Plant physiology, 2009, 150(4): 1648-1655.
 +
</ref>
 +
* <ref name="ref5">
 +
Eulgem T, Somssich I E. Networks of WRKY transcription factors in defense signaling[J]. Current opinion in plant biology, 2007, 10(4): 366-371.
 +
</ref>
 +
* <ref name="ref6">
 +
Ross C A, Liu Y, Shen Q J. The WRKY gene family in rice (Oryza sativa)[J]. Journal of Integrative Plant Biology, 2007, 49(6): 827-842.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==

Revision as of 07:38, 24 March 2015

The transcription factor OsWRKY76, is a member of rice group IIa WRKY[1][2][3].

Annotated Information

Function

  • OsWRKY76 encodes a group IIa WRKY transcription factor of rice. OsWRKY76 plays dual and opposing roles in blast disease resistance and cold tolerance. OsWRKY76 binds specifically to the W-box element. OsWRKY76 acts as a transcriptional repressor via binding to the W-box[1].


GO assignment(s): GO:0003700,GO:0005634, GO:0043565, GO:0045449

Mutation

Transgenic plants[1]:

  • Transgenic plants showed more severe symptoms, which often blasted the whole plant, compared with non-transformed control (NT) plants both in the excised leaves and in the intact plants.
  • Observations of cross-sections of the inoculated leaf blades revealed that in NT plants, the spread of mycelia was generally limited to the spaces between motor cells and vascular tissues at 4 dai.
  • In W76-OX plants, however, the mycelia vigorously spread into parenchymatous tissues in addition to motor cells and vascular tissues, causing a collapse of the parenchyma, and hyphae already spread over the leaf surface at 4 dai
  • These results indicate that the constitutive overexpression of OsWRKY76 suppresses basal resistance to M. oryzae to a large extent.

Expression

  • The expression of OsWRKY76 was induced within 48 h after inoculation with rice blast fungus (Magnaporthe oryzae), and by wounding, low temperature, benzothiadiazole, and abscisic acid[1].
  • OsWRKY76 showed sequence-specific DNA binding to the W-box element in vitro and exhibited W-box-mediated transcriptional repressor activity in cultured rice cells. Overexpression of OsWRKY76 in rice plants resulted in drastically increased susceptibility to M. oryzae, but improved tolerance to cold stress. Microarray analysis revealed that overexpression of OsWRKY76 suppresses the induction of a specific set of PR genes and of genes involved in phytoalexin synthesis after inoculation with blast fungus, consistent with the observation that the levels of phytoalexins in the transgenic rice plants remained significantly lower than those in non-transformed control plants[1].
  • Overexpression of OsWRKY76 led to the increased expression of abiotic stress-associated genes such as peroxidase and lipid metabolism genes. Overexpression of OsWRKY76 increases susceptibility to the blast fungus in rice and confers cold tolerance to rice via protection of membranes from damage[1].

Subcellular localization

Green fluorescent protein-fused OsWRKY76 localized to the nuclei in rice epidermal cells, which means OsWRKY76 protein is targeted to the nucleus[1].

Evolution

Figure 1. Phylogenetic tree of M.grisea-inducible OsWRKYs constructed using the neighbor-joining method.(from reference [2]).
  • The sequence analysis for 15 M. grisea-inducible OsWRKYs indicated that 5, OsWRKY30, OsWRKY70, OsWRKY82, OsWRKY84, and OsWRKY85, belong to WRKY group I which contains two WRKY domains(Fig. 2)[2]。 Among the WRKY group IIc family, four M. grisea-inducible WRKYs were identified, OsWRKY7, OsWRKY10, OsWRKY11, and OsWRKY67(Fig. 1). The remaining M. grisea-inducible WRKYs were included in four different groups: 'IIa' (OsWRKY62 and OsWRKY76), IIb (OsWRKY32), IId (OsWRKY83), and III (OsWRKY45 and OsWRKY64) (Fig. 1)[2][3].

Knowledge Extension

Figure 2. Modeling the WRKY-smRNA interactome during reprogramming of defense responses.(from reference [4]).
  • The WRKY TF superfamily consists of 74 and 109 members in Arabidopsis (Arabidopsis thaliana) and rice (Oryza sativa), respectively[4][5][6].
  • The current data point toward the existence of a WRKY-smRNA interactome, where on the one hand, pathogen attack triggers the expression of WRKY genes that regulate cellular smRNA populations, and on the other hand, several differentially regulated smRNAs modulateWRKY TF levels by targeting their transcripts (Fig. 2)[4].
  • During pathogen attack, smRNA-generating loci may be under the control of WRKY TFs; at the same time, WRKY abundance may be regulated by smRNAs. RdR, RNA-directed RNA polymerase(Fig. 2)[4].

Labs working on this gene

  • Disease Resistant Crops Research Unit, GMO Research Center, National Institute of Agrobiological Sciences, 2-1-2 Kannondai,

Tsukuba, Ibaraki 305-8602, Japan

  • Biotechnology Research Center, The University of Tokyo, 1-1-1 Yayoi, Bunkyo-ku, Tokyo 113-8657, Japan
  • Department of Biosciences, Teikyo University, 1-1 Toyosatodai, Utsunomiya, Tochigi 320-8551, Japan
  • Sakata Seed Corporation, Kimitsu Research Station, 358 Uchikoshi, Sodegaura, Chiba 299-0217, Japan

References

  1. ↑ 1.0 1.1 1.2 1.3 1.4 1.5 1.6 Yokotani N, Sato Y, Tanabe S, et al. WRKY76 is a rice transcriptional repressor playing opposite roles in blast disease resistance and cold stress tolerance[J]. Journal of experimental botany, 2013, 64(16): 5085-5097.
  2. ↑ 2.0 2.1 2.2 2.3 Ryu H S, Han M, Lee S K, et al. A comprehensive expression analysis of the WRKY gene superfamily in rice plants during defense response[J]. Plant cell reports, 2006, 25(8): 836-847.
  3. ↑ 3.0 3.1 Peng Y, Bartley L E, Canlas P, et al. OsWRKY IIa transcription factors modulate rice innate immunity[J]. Rice, 2010, 3(1): 36-42.
  4. ↑ 4.0 4.1 4.2 4.3 Pandey S P, Somssich I E. The role of WRKY transcription factors in plant immunity[J]. Plant physiology, 2009, 150(4): 1648-1655.
  5. ↑ Eulgem T, Somssich I E. Networks of WRKY transcription factors in defense signaling[J]. Current opinion in plant biology, 2007, 10(4): 366-371.
  6. ↑ Ross C A, Liu Y, Shen Q J. The WRKY gene family in rice (Oryza sativa)[J]. Journal of Integrative Plant Biology, 2007, 49(6): 827-842.

Structured Information

Gene Name

Os09g0417600

Description

WRKY transcription factor 76

Version

NM_001069719.1 GI:115479180 GeneID:4347069

Length

1460 bp

Definition

Oryza sativa Japonica Group Os09g0417600, complete gene.

Source

Oryza sativa Japonica Group 

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 9

Location

Chromosome 9:15629908..15631367

Sequence Coding Region

15630160..15630978,15631098..15631262

Expression

GEO Profiles:Os09g0417600

Genome Context

<gbrowseImage1> name=NC_008402:15629908..15631367 source=RiceChromosome09 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008402:15629908..15631367 source=RiceChromosome09 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggacgcggcgtggcgcggcggcgttggctgctcgccggtctgcctcgacctctgcgtcgggctgtcgccggtgcgggagccgtcggcggcgaggcacgagctgcttgaccggccggccggctgccgcggcggtggggattccaagtcgatgaccaatgacgaggcgaagatcgtcgaggcgaaggtcactcagatgagcgaggagaatcggcggctgaccgaggtgatcgcccgcctgtacggcggccaaatcccgcggctcggcctcgacggctcggcctcgccgccgcggccggtgtcgccgttatcgggcaagaagaggagcagggagagcatggagacggcgaattcctgcgacgccaacagcaacaggcatcagggcggcgacgccgaccacgccgagagcttcgccgccgacgatggcacctgccggaggatcaaggtcagccgggtgtgcaggcggatcgacccgtcggacacctccctggtggtcaaggacgggtaccaatggcggaagtacgggcagaaggtgacgcgcgacaacccgtcgccgagggcctacttccggtgcgccttcgcgccatcgtgcccggtgaagaagaaggtgcagcggagcgcggaggacagctcgctgctggtggcgacgtacgagggcgagcacaaccacccgcacccgtctccgcgcgccggcgagctcccggcggcggcggggggggccggtggctcgctgccgtgctccatctccatcaactcctccggcccgaccatcacgctcgacctcaccaagaacgggggagccgtgcaggtggtcgaggcggcgcatccgccgccgccgccggacctcaaggaggtgtgccgggaggtcgcgtcgccggagttccggaccgcgctggtggagcagatggccagcgcgctcaccagcgaccccaagttcaccggcgcgctcgccgcggcgatcctccagaagctgcccgaattctag</cdnaseq>

Protein Sequence

<aaseq>MDAAWRGGVGCSPVCLDLCVGLSPVREPSAARHELLDRPAGCRG GGDSKSMTNDEAKIVEAKVTQMSEENRRLTEVIARLYGGQIPRLGLDGSASPPRPVSP LSGKKRSRESMETANSCDANSNRHQGGDADHAESFAADDGTCRRIKVSRVCRRIDPSD TSLVVKDGYQWRKYGQKVTRDNPSPRAYFRCAFAPSCPVKKKVQRSAEDSSLLVATYE GEHNHPHPSPRAGELPAAAGGAGGSLPCSISINSSGPTITLDLTKNGGAVQVVEAAHP PPPPDLKEVCREVASPEFRTALVEQMASALTSDPKFTGALAAAILQKLPEF</aaseq>

Gene Sequence

<dnaseqindica>390..1208#106..270#aagtgtttgtacttggctttgctggcctgtttctgttttgattactcgagctccagagcacagcagcagagagacgcgagctgttcgtggtcgtcgtcgtcgtcgatggacgcggcgtggcgcggcggcgttggctgctcgccggtctgcctcgacctctgcgtcgggctgtcgccggtgcgggagccgtcggcggcgaggcacgagctgcttgaccggccggccggctgccgcggcggtggggattccaagtcgatgaccaatgacgaggtgaggtgttcttgattgattgattgattgattgattgattgattgatcggttgattgctcccgcggattcggttcttgcttggttttgatcgttggaaatgtggggggattccttcaggcgaagatcgtcgaggcgaaggtcactcagatgagcgaggagaatcggcggctgaccgaggtgatcgcccgcctgtacggcggccaaatcccgcggctcggcctcgacggctcggcctcgccgccgcggccggtgtcgccgttatcgggcaagaagaggagcagggagagcatggagacggcgaattcctgcgacgccaacagcaacaggcatcagggcggcgacgccgaccacgccgagagcttcgccgccgacgatggcacctgccggaggatcaaggtcagccgggtgtgcaggcggatcgacccgtcggacacctccctggtggtcaaggacgggtaccaatggcggaagtacgggcagaaggtgacgcgcgacaacccgtcgccgagggcctacttccggtgcgccttcgcgccatcgtgcccggtgaagaagaaggtgcagcggagcgcggaggacagctcgctgctggtggcgacgtacgagggcgagcacaaccacccgcacccgtctccgcgcgccggcgagctcccggcggcggcggggggggccggtggctcgctgccgtgctccatctccatcaactcctccggcccgaccatcacgctcgacctcaccaagaacgggggagccgtgcaggtggtcgaggcggcgcatccgccgccgccgccggacctcaaggaggtgtgccgggaggtcgcgtcgccggagttccggaccgcgctggtggagcagatggccagcgcgctcaccagcgaccccaagttcaccggcgcgctcgccgcggcgatcctccagaagctgcccgaattctagcttcctttacaattctccaattcttcttacaggaaaaaacatagaggcgcatttcaatagagattagagcttaatctccccccaaatttgaaaattttatacagggtaagaattccgaatgcttttctgctgcttttaggatgtgaattgtactctctcataataacctgttggtccttgggccgtcggaagaagattgcgggcttctatcgggcctcacgatcctgagcccaattgcgaggctccttgagc</dnaseqindica>

External Link(s)

NCBI Gene:Os09g0417600, RefSeq:Os09g0417600

Retrieved from "https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os09g0417600&oldid=184940"