Difference between revisions of "Os09g0522100"
(→Function) |
|||
| Line 4: | Line 4: | ||
===Function=== | ===Function=== | ||
Please input function information here. | Please input function information here. | ||
| + | The alignment of amino acids showed that V14 was also conserved in these rice CBF/DREB1 proteins. However, the E19 is substituted by valine in a few rice CBF/DREB1 proteins. Similar to the structure of Arabidopsis CBF/DREB1genes, three rice genes (Os09g0522000, Os09g0522100 and Os09g0522200) designed as OsCBF1, OsCBF2and OsCBF3, respectively, are organized in tandem on chromosome 9, indicating that they might play similar functions as Arabidops is CBF/DREB1genes in cold acclimation. | ||
| + | 1.Cold acclimation increased cold tolerance of rice seedlings | ||
| + | Plants from temperate regions can increase their freezing tolerance after cold acclimation. However, rice seedlings can not survive at freezing temperature and exhibit growth retardation at the temperature below 12 °C. To check whether rice can be acclimated to cold stress, we pretreated 3-leaf seedlings at 10 °C for 1 d to mimic cold acclimation, and then evaluated the cold tolerance of rice seedlings at 5 °C. Without cold acclimation, the survival rates of Nipponbare and 93-11 were about 50% after 5 °C treatment for 7 d and 3 d, respectively (Fig. 2). Pretreatment at 10 °C increased cold tolerance of rice seedlings significantly. The survival rate of Nipponbare seedlings after cold acclimation was 88.4%, while that of control plants was 50.9%. Similarly, the survival rate of 93-11 after cold acclimation was 90.9%, while that of control was 52.5%. The increase of survival rate due to cold acclimation was 37.5 percent point in Nipponbare and 38.4 percent point in 93-11, respectively. These results suggest that 10 °C cold acclimation can enhance the cold tolerance of Nipponbare and 93-11 seedlings. | ||
| + | 2.Cold acclimation decrease electrolyte leakage under cold stress | ||
| + | The electrolyte leakage (EL) of leaves is an effective physiological index to evaluate cold-induced membrane injury (Yu et al, 2006). In order to elucidate the mechanism of increased cold tolerance due to cold acclimation, we examined the time-course EL after exposure to chilling stress at 5 °C. As shown in Fig. 3-A, both Nipponbare and 93-11 maintained a low-level EL under normal growth conditions. The EL of acclimated 93-11 was higher than that of unacclimated 93-11 before chilling stress, implying that cold acclimation caused damage to 93-11. After the chilling treatment, the EL of Nipponbare without cold acclimation increased from 6 h and then decreased from 12 h. However, the EL of Nipponbare after cold acclimation did not increase significantly after the treatment. Correspondingly, the EL of 93-11 without cold acclimation increased rapidly after the treatment, while the EL of 93-11 after cold acclimation decreased during 6–24 h and displayed lower than that without cold acclimation. These results suggested that cold acclimation decreased the EL of both Nipponbare and 93-11 under chilling stress. To evaluate the influence of cold acclimation, we compared the time-course amplitude of EL between the two rice varieties. As shown in Fig. 3-B, the amplitude of leaf EL was subzero before treatment for 6 h, indicating that the process of cold acclimation resulted in the damage to seedlings. The damage was more serious in 93-11, implying that 93-11 was much more sensitive to cold stress than Nipponbare. However, the amplitude of leaf EL in 93-11 increased rapidly and was higher than that inNipponbare after 24 h- treatment. These results suggest that 93-11 might have better ability to acclimate to cold stress. | ||
===Expression=== | ===Expression=== | ||
Revision as of 01:05, 4 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
Please input function information here.
The alignment of amino acids showed that V14 was also conserved in these rice CBF/DREB1 proteins. However, the E19 is substituted by valine in a few rice CBF/DREB1 proteins. Similar to the structure of Arabidopsis CBF/DREB1genes, three rice genes (Os09g0522000, Os09g0522100 and Os09g0522200) designed as OsCBF1, OsCBF2and OsCBF3, respectively, are organized in tandem on chromosome 9, indicating that they might play similar functions as Arabidops is CBF/DREB1genes in cold acclimation.
1.Cold acclimation increased cold tolerance of rice seedlings
Plants from temperate regions can increase their freezing tolerance after cold acclimation. However, rice seedlings can not survive at freezing temperature and exhibit growth retardation at the temperature below 12 °C. To check whether rice can be acclimated to cold stress, we pretreated 3-leaf seedlings at 10 °C for 1 d to mimic cold acclimation, and then evaluated the cold tolerance of rice seedlings at 5 °C. Without cold acclimation, the survival rates of Nipponbare and 93-11 were about 50% after 5 °C treatment for 7 d and 3 d, respectively (Fig. 2). Pretreatment at 10 °C increased cold tolerance of rice seedlings significantly. The survival rate of Nipponbare seedlings after cold acclimation was 88.4%, while that of control plants was 50.9%. Similarly, the survival rate of 93-11 after cold acclimation was 90.9%, while that of control was 52.5%. The increase of survival rate due to cold acclimation was 37.5 percent point in Nipponbare and 38.4 percent point in 93-11, respectively. These results suggest that 10 °C cold acclimation can enhance the cold tolerance of Nipponbare and 93-11 seedlings.
2.Cold acclimation decrease electrolyte leakage under cold stress
The electrolyte leakage (EL) of leaves is an effective physiological index to evaluate cold-induced membrane injury (Yu et al, 2006). In order to elucidate the mechanism of increased cold tolerance due to cold acclimation, we examined the time-course EL after exposure to chilling stress at 5 °C. As shown in Fig. 3-A, both Nipponbare and 93-11 maintained a low-level EL under normal growth conditions. The EL of acclimated 93-11 was higher than that of unacclimated 93-11 before chilling stress, implying that cold acclimation caused damage to 93-11. After the chilling treatment, the EL of Nipponbare without cold acclimation increased from 6 h and then decreased from 12 h. However, the EL of Nipponbare after cold acclimation did not increase significantly after the treatment. Correspondingly, the EL of 93-11 without cold acclimation increased rapidly after the treatment, while the EL of 93-11 after cold acclimation decreased during 6–24 h and displayed lower than that without cold acclimation. These results suggested that cold acclimation decreased the EL of both Nipponbare and 93-11 under chilling stress. To evaluate the influence of cold acclimation, we compared the time-course amplitude of EL between the two rice varieties. As shown in Fig. 3-B, the amplitude of leaf EL was subzero before treatment for 6 h, indicating that the process of cold acclimation resulted in the damage to seedlings. The damage was more serious in 93-11, implying that 93-11 was much more sensitive to cold stress than Nipponbare. However, the amplitude of leaf EL in 93-11 increased rapidly and was higher than that inNipponbare after 24 h- treatment. These results suggest that 93-11 might have better ability to acclimate to cold stress.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os09g0522100 |
|---|---|
| Description |
Similar to C-repeat binding factor 3-like protein |
| Version |
NM_001070246.1 GI:115480234 GeneID:4347619 |
| Length |
741 bp |
| Definition |
Oryza sativa Japonica Group Os09g0522100, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 9:21142100..21142840 |
| Sequence Coding Region |
21142100..21142840 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008402:21142100..21142840 source=RiceChromosome09 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008402:21142100..21142840 source=RiceChromosome09 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggacatggccggccacgaggtgaactccagctcgtcgtcgtcgggggcggagtcgtcgtcgtcctcgtcggggcggcagcagtacaagaagcggcccgcggggcgcaccaagttcagggagacgcggcacccggtgtaccgcggcgtgcggcgccgcggcggggcggggcggtgggtgtgcgaggtgcgcgtcccggggaagcgcggcgcgcgcctgtggctcggcacgtacgtcaccgccgaggccgcggcgcgcgcgcacgacgccgccatgatcgcgctccgcggcggcgccggcggaggcggcgcggcgtgcctcaacttccaggactccgcgtggctgctcgccgtcccgcccgccgcgccgtccgacctggccggcgtccgccgcgcggccaccgaggccgtcgcgggcttcctccagcgcaacaagaccacgaacggcgcctccgtcgcggaggccatggacgaggccacctccggcgtgtccgcgccgccgccgctggccaacaatgccggctcgtcggagacgcccggaccttcatcgatcgacggaacggctgacacggcggcgggggcggcgctggacatgttcgagctcgacttcttcggcgaaatggactacgacacgtactacgcgagcctggccgaggggcttctcatggagccgccgccggcggcgaccgcactctgggacaacggcgacgaaggcgctgacatcgcgctctggagctactga</cdnaseq> |
| Protein Sequence |
<aaseq>MDMAGHEVNSSSSSSGAESSSSSSGRQQYKKRPAGRTKFRETRH PVYRGVRRRGGAGRWVCEVRVPGKRGARLWLGTYVTAEAAARAHDAAMIALRGGAGGG GAACLNFQDSAWLLAVPPAAPSDLAGVRRAATEAVAGFLQRNKTTNGASVAEAMDEAT SGVSAPPPLANNAGSSETPGPSSIDGTADTAAGAALDMFELDFFGEMDYDTYYASLAE GLLMEPPPAATALWDNGDEGADIALWSY</aaseq> |
| Gene Sequence |
<dnaseqindica>1..741#atggacatggccggccacgaggtgaactccagctcgtcgtcgtcgggggcggagtcgtcgtcgtcctcgtcggggcggcagcagtacaagaagcggcccgcggggcgcaccaagttcagggagacgcggcacccggtgtaccgcggcgtgcggcgccgcggcggggcggggcggtgggtgtgcgaggtgcgcgtcccggggaagcgcggcgcgcgcctgtggctcggcacgtacgtcaccgccgaggccgcggcgcgcgcgcacgacgccgccatgatcgcgctccgcggcggcgccggcggaggcggcgcggcgtgcctcaacttccaggactccgcgtggctgctcgccgtcccgcccgccgcgccgtccgacctggccggcgtccgccgcgcggccaccgaggccgtcgcgggcttcctccagcgcaacaagaccacgaacggcgcctccgtcgcggaggccatggacgaggccacctccggcgtgtccgcgccgccgccgctggccaacaatgccggctcgtcggagacgcccggaccttcatcgatcgacggaacggctgacacggcggcgggggcggcgctggacatgttcgagctcgacttcttcggcgaaatggactacgacacgtactacgcgagcctggccgaggggcttctcatggagccgccgccggcggcgaccgcactctgggacaacggcgacgaaggcgctgacatcgcgctctggagctactga</dnaseqindica> |
| External Link(s) |
