Difference between revisions of "Os09g0522200"
(→Function) |
|||
| Line 3: | Line 3: | ||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | + | Os09g0522200(''OsDREB1A'') is one of the five ''OsDREB'' genes( ''OsDREB1A'', ''OsDREB1B'', ''OsDREB1C'', ''OsDREB1D'', and ''OsDREB2A'') in rice, Oryza sativa L. isolated by Dubouzet et al for ''DREB'' homologs. The transcription factors DREBs/CBFs specifically interact with the dehydration-responsive element/Crepeat (DRE/CRT) cis-acting element (core motif: G/ACCGAC) and control the expression of many stress-inducible genes in Arabidopsis. To compare the function of ''OsDREB1A'' with that of ''DREB1A'', we generated transgenic plants in which the ''OsDREB1A'' cDNA was over-expressed (35S:OsDREB1A).The tolerance to freezing and high-salt stresses of the 35S:OsDREB1A plants was compared with those of the wild-type and 35S:DREB1Ac plants which had the lowest level of stress tolerance among the 35S:DREB1A transgenic Arabidopsis plants.Over-expression of OsDREB1A in transgenic Arabidopsis induced overexpression of target stress-inducible genes of Arabidopsis DREB1A resulting in plants with higher tolerance to drought, high-salt, and freezing stresses. This indicated that ''OsDREB1A'' has functional similarity to ''DREB1A''. However, in microarray and RNA blot analyses, some stress-inducible target genes of the ''DREB1A'' proteins that have only ACCGAC as DRE were not over-expressed in the ''OsDREB1A'' transgenic Arabidopsis. The ''OsDREB1A'' protein bound to GCCGAC more preferentially than to ACCGAC whereas the ''DREB1A'' proteins bound to both GCCGAC and ACCGAC efficiently. ''OsDREB1A'' is potentially useful for producing transgenic monocots that are tolerant to drought, high-salt, and/or cold stresses. | |
===Expression=== | ===Expression=== | ||
Revision as of 04:35, 10 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
Os09g0522200(OsDREB1A) is one of the five OsDREB genes( OsDREB1A, OsDREB1B, OsDREB1C, OsDREB1D, and OsDREB2A) in rice, Oryza sativa L. isolated by Dubouzet et al for DREB homologs. The transcription factors DREBs/CBFs specifically interact with the dehydration-responsive element/Crepeat (DRE/CRT) cis-acting element (core motif: G/ACCGAC) and control the expression of many stress-inducible genes in Arabidopsis. To compare the function of OsDREB1A with that of DREB1A, we generated transgenic plants in which the OsDREB1A cDNA was over-expressed (35S:OsDREB1A).The tolerance to freezing and high-salt stresses of the 35S:OsDREB1A plants was compared with those of the wild-type and 35S:DREB1Ac plants which had the lowest level of stress tolerance among the 35S:DREB1A transgenic Arabidopsis plants.Over-expression of OsDREB1A in transgenic Arabidopsis induced overexpression of target stress-inducible genes of Arabidopsis DREB1A resulting in plants with higher tolerance to drought, high-salt, and freezing stresses. This indicated that OsDREB1A has functional similarity to DREB1A. However, in microarray and RNA blot analyses, some stress-inducible target genes of the DREB1A proteins that have only ACCGAC as DRE were not over-expressed in the OsDREB1A transgenic Arabidopsis. The OsDREB1A protein bound to GCCGAC more preferentially than to ACCGAC whereas the DREB1A proteins bound to both GCCGAC and ACCGAC efficiently. OsDREB1A is potentially useful for producing transgenic monocots that are tolerant to drought, high-salt, and/or cold stresses.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os09g0522200 |
|---|---|
| Description |
DRE-binding protein 1A |
| Version |
NM_001070247.1 GI:115480236 GeneID:4347620 |
| Length |
920 bp |
| Definition |
Oryza sativa Japonica Group Os09g0522200, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 9:21146055..21146974 |
| Sequence Coding Region |
21146179..21146895 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008402:21146055..21146974 source=RiceChromosome09 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008402:21146055..21146974 source=RiceChromosome09 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgtgcgggatcaagcaggagatgagcggcgagtcgtcggggtcgccgtgcagctcggcgtcggcggagcggcagcaccagacggtgtggacggcgccgccgaagaggccggcggggcggaccaagttcagggagacgaggcacccggtgttccgcggcgtgcggcggaggggcaatgccgggaggtgggtgtgcgaggtgcgggtgcccgggcggcgcggctgcaggctctggctcggcacgttcgacaccgccgagggcgcggcgcgcgcgcacgacgccgccatgctcgccatcaacgccggcggcggcggcggcgggggagcatgctgcctcaacttcgccgactccgcgtggctcctcgccgtgccgcgctcctaccgcaccctcgccgacgtccgccacgccgtcgccgaggccgtcgaggacttcttccggcgccgcctcgccgacgacgcgctgtccgccacgtcgtcgtcctcgacgacgccgtccaccccacgcaccgacgacgacgaggagtccgccgccaccgacggcgacgagtcctcctccccggccagcgacctggcgttcgaactggacgtcctgagtgacatgggctgggacctgtactacgcgagcttggcgcaggggatgctcatggagccaccatcggcggcgctcggcgacgacggtgacgccatcctcgccgacgtcccactctggagctactag</cdnaseq> |
| Protein Sequence |
<aaseq>MCGIKQEMSGESSGSPCSSASAERQHQTVWTAPPKRPAGRTKFR ETRHPVFRGVRRRGNAGRWVCEVRVPGRRGCRLWLGTFDTAEGAARAHDAAMLAINAG GGGGGGACCLNFADSAWLLAVPRSYRTLADVRHAVAEAVEDFFRRRLADDALSATSSS STTPSTPRTDDDEESAATDGDESSSPASDLAFELDVLSDMGWDLYYASLAQGMLMEPP SAALGDDGDAILADVPLWSY</aaseq> |
| Gene Sequence |
<dnaseqindica>80..796#atcgccattaccacactcgagcagagcaaatacagttcaggaatcaggagcaagcagaaacacacacacaaatccgaagatgtgcgggatcaagcaggagatgagcggcgagtcgtcggggtcgccgtgcagctcggcgtcggcggagcggcagcaccagacggtgtggacggcgccgccgaagaggccggcggggcggaccaagttcagggagacgaggcacccggtgttccgcggcgtgcggcggaggggcaatgccgggaggtgggtgtgcgaggtgcgggtgcccgggcggcgcggctgcaggctctggctcggcacgttcgacaccgccgagggcgcggcgcgcgcgcacgacgccgccatgctcgccatcaacgccggcggcggcggcggcgggggagcatgctgcctcaacttcgccgactccgcgtggctcctcgccgtgccgcgctcctaccgcaccctcgccgacgtccgccacgccgtcgccgaggccgtcgaggacttcttccggcgccgcctcgccgacgacgcgctgtccgccacgtcgtcgtcctcgacgacgccgtccaccccacgcaccgacgacgacgaggagtccgccgccaccgacggcgacgagtcctcctccccggccagcgacctggcgttcgaactggacgtcctgagtgacatgggctgggacctgtactacgcgagcttggcgcaggggatgctcatggagccaccatcggcggcgctcggcgacgacggtgacgccatcctcgccgacgtcccactctggagctactagagctcaatcaactgtacaattttgcctcttttttctctcttttctggcttccgatgccaaaattttggtactgtacggacactactttcggtaatgtgatggaacaagttgcaaaacacagagc</dnaseqindica> |
| External Link(s) |
