Difference between revisions of "Os10g0100200"
(→Function) |
|||
| Line 2: | Line 2: | ||
==Annotated Information== | ==Annotated Information== | ||
| − | + | This gene encodes an Hypothetical protein. Some hypothetical proteins are well conserved among many organisms and presumably perform a common biological role that is as yet undefined. The other hypothetical proteins are specific to only one organism where they exert a specialized role. Functional assignment of hypothetical proteins is, therefore, indispensable for understanding the fundamental or specific biological phenomena of diverse organisms. Because the threedimensional structure of a protein is very important for the understanding of its function at the molecular level, structural analysis of hypothetical proteins can give valuable functional clues that may not be evident from sequence data alone. | |
| − | |||
===Expression=== | ===Expression=== | ||
Revision as of 13:18, 22 May 2014
Please input one-sentence summary here.
Contents
Annotated Information
This gene encodes an Hypothetical protein. Some hypothetical proteins are well conserved among many organisms and presumably perform a common biological role that is as yet undefined. The other hypothetical proteins are specific to only one organism where they exert a specialized role. Functional assignment of hypothetical proteins is, therefore, indispensable for understanding the fundamental or specific biological phenomena of diverse organisms. Because the threedimensional structure of a protein is very important for the understanding of its function at the molecular level, structural analysis of hypothetical proteins can give valuable functional clues that may not be evident from sequence data alone.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os10g0100200 |
|---|---|
| Description |
Hypothetical protein |
| Version |
NM_001070542.1 GI:115480827 GeneID:4347934 |
| Length |
791 bp |
| Definition |
Oryza sativa Japonica Group Os10g0100200, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 10:23934..24724 |
| Sequence Coding Region |
24293..24559 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008403:23934..24724 source=RiceChromosome10 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008403:23934..24724 source=RiceChromosome10 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgtgcacggatttgccgccgcctgcttctcccctttcatcgtcgtcgtctacttgctgcacgagcccacctcgcgcacacggatttctcccacccccttcccccttgccgcctccgatgcctttgcctcgcgtgcgcacagttccaccttcgccgtcgccgaagaggcgctcggtgatacctgcgggagaaagaggaaggaggggagaggaggaagaagaagcagcgactgacatgtggggacccactgtgatagacttaaaatag</cdnaseq> |
| Protein Sequence |
<aaseq>MCTDLPPPASPLSSSSSTCCTSPPRAHGFLPPPSPLPPPMPLPR VRTVPPSPSPKRRSVIPAGERGRRGEEEEEAATDMWGPTVIDLK</aaseq> |
| Gene Sequence |
<dnaseqindica>360..626#aggagcacggggaggagcactgctatggcaggtgaagacggtgcccgccccgccgctcgccgcagcctgccatagcatcatcctctggccgccctgccgccgcagccgccggcctccgctcgctacagcccgccgcctccgctcaccgcagccgttaccccgcctccgcccgccccgccactcgctgcaacctgtcacctcgcagcctgacgacggtgtcgaggtgggagaagggagacaaggcggcgtgaagggagtggtggcgctagcgagataggaaatgaggcggcagtggggccggcttcccctttcgccgtcgccgtagtcttcgtcatccctcgccgtcgccgtcgactcgcatgtgcacggatttgccgccgcctgcttctcccctttcatcgtcgtcgtctacttgctgcacgagcccacctcgcgcacacggatttctcccacccccttcccccttgccgcctccgatgcctttgcctcgcgtgcgcacagttccaccttcgccgtcgccgaagaggcgctcggtgatacctgcgggagaaagaggaaggaggggagaggaggaagaagaagcagcgactgacatgtggggacccactgtgatagacttaaaatagagtgggtagatggagaggctgttggagcgagtaagtagtttgactagccaaataagatggagagttggctatatgggtgtttggagagtccgatttggagaggctattggagatgctcttataactgatgagaattaattacagaatgataaaggtttagttgtc</dnaseqindica> |
| External Link(s) |