Difference between revisions of "Rps15"
(Created page with "{{Plastid| GeneName = rps15| Description = ribosomal protein S15| Version = GeneID:3131437| Length = 273 bp| Definition = Oryza sativa Japonica Group ''rps15'', Plastid gene.|...") |
|||
| Line 27: | Line 27: | ||
AA = <aaseq>MKKKGGRKIFGFMVKEEKEENWGSVEFQVFSFTNKIRRLASHLELHKKDFSSERGLRRLLGKRQRLLAYLAKKNRVRYKKLISQLDIRER</aaseq>| | AA = <aaseq>MKKKGGRKIFGFMVKEEKEENWGSVEFQVFSFTNKIRRLASHLELHKKDFSSERGLRRLLGKRQRLLAYLAKKNRVRYKKLISQLDIRER</aaseq>| | ||
DNA = <dnaseqindica>1..273#ttaccgctccctaatatccaactgactgattaatttcttataacgtactctatttttctttgccaaataagccagcaaacgttgacgttttcccaaaagtcttcggagacctctttccgatgaaaaatcttttttgtgtaattccaaatgtgaagcaagtctccgtatcttattggtgaaactgaatacttgaaattcaacagaaccccagttttcttctttttcttctttaaccataaatccaaaaatttttctacctcctttctttttcat</dnaseqindica>| | DNA = <dnaseqindica>1..273#ttaccgctccctaatatccaactgactgattaatttcttataacgtactctatttttctttgccaaataagccagcaaacgttgacgttttcccaaaagtcttcggagacctctttccgatgaaaaatcttttttgtgtaattccaaatgtgaagcaagtctccgtatcttattggtgaaactgaatacttgaaattcaacagaaccccagttttcttctttttcttctttaaccataaatccaaaaatttttctacctcctttctttttcat</dnaseqindica>| | ||
| + | Link = [http://www.ncbi.nlm.nih.gov/gene?term=3131437 NCBI Gene:rps15] | ||
}} | }} | ||
[[Category:Genes]] | [[Category:Genes]] | ||
Revision as of 10:31, 27 October 2012
Please input one-sentence summary here.
Contents
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
rps15 |
|---|---|
| Description |
ribosomal protein S15 |
| Version |
GeneID:3131437 |
| Length |
273 bp |
| Definition |
Oryza sativa Japonica Group rps15, Plastid gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Plastid:100818..101090 |
| Sequence Coding Region |
100818..101090 |
| Genome Context |
<gbrowseImage1> name=NC_001320:100818..101090 source=Rice_Japonica_Plastid preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_001320:100818..101090 source=Rice_Japonica_Plastid preset=GeneLocation </gbrowseImage2> |
| Protein Sequence |
<aaseq>MKKKGGRKIFGFMVKEEKEENWGSVEFQVFSFTNKIRRLASHLELHKKDFSSERGLRRLLGKRQRLLAYLAKKNRVRYKKLISQLDIRER</aaseq> |
| Gene Sequence |
<dnaseqindica>1..273#ttaccgctccctaatatccaactgactgattaatttcttataacgtactctatttttctttgccaaataagccagcaaacgttgacgttttcccaaaagtcttcggagacctctttccgatgaaaaatcttttttgtgtaattccaaatgtgaagcaagtctccgtatcttattggtgaaactgaatacttgaaattcaacagaaccccagttttcttctttttcttctttaaccataaatccaaaaatttttctacctcctttctttttcat</dnaseqindica> |
| External Link(s) |