Difference between revisions of "Os11g0523800"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 8: Line 8:
 
'''''OsARF1''''' is the first full-length member of auxin response factor (ARF) gene family to be cloned from monocot plant<ref name="ref1" />. It was shown to be essential for developmental growth stages of the life cycle of rice. The knock down of '''''OsARF1''''' turned off some key switches for transformation from vegetative stage to the reproductive stage<ref name="ref2" />. As an early response gene in auxin signaling, '''''OsARF1''''' could be associated with embryogenesis and may play a key role in fertility and regulate quite a few downstream genes associated with growth and reproduction<ref name="ref1" /><ref name="ref2" />. Further elucidation of the downstream targets of '''''Os-ARF1''''' will help to understand the regulation of plant growth by auxin-mediated gene expression<ref name="ref2" />.
 
'''''OsARF1''''' is the first full-length member of auxin response factor (ARF) gene family to be cloned from monocot plant<ref name="ref1" />. It was shown to be essential for developmental growth stages of the life cycle of rice. The knock down of '''''OsARF1''''' turned off some key switches for transformation from vegetative stage to the reproductive stage<ref name="ref2" />. As an early response gene in auxin signaling, '''''OsARF1''''' could be associated with embryogenesis and may play a key role in fertility and regulate quite a few downstream genes associated with growth and reproduction<ref name="ref1" /><ref name="ref2" />. Further elucidation of the downstream targets of '''''Os-ARF1''''' will help to understand the regulation of plant growth by auxin-mediated gene expression<ref name="ref2" />.
  
'''GO assignment(s):''' GO:0003677, GO:0005634, GO:0006445, GO:0009725, GO:0045449, GO:0046983
+
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0003677 GO:0003677], [http://amigo.geneontology.org/amigo/term/GO:0005634 GO:0005634], [http://amigo.geneontology.org/amigo/term/GO:0006445 GO:0006445], [http://amigo.geneontology.org/amigo/term/GO:0009725 GO:0009725], [http://amigo.geneontology.org/amigo/term/GO:0045449 GO:0045449], [http://amigo.geneontology.org/amigo/term/GO:0046983 GO:0046983]
  
 
===Wild Type VS. Mutant===
 
===Wild Type VS. Mutant===

Revision as of 13:33, 25 May 2014

The rice Os11g0523800 was reported as OsARF1 in 2002 and 2008 by researchers from Japan and Egypt respectively[1][2].

Annotated Information

Figure 1. Mutant VS. WT(from reference) [2].
Figure 2. Transcript abundance of OsARF1 in wild type rice from [2].
Figure 3. Auxin concentration dependence of OsARF1 expression.[1].

Function

OsARF1 is the first full-length member of auxin response factor (ARF) gene family to be cloned from monocot plant[1]. It was shown to be essential for developmental growth stages of the life cycle of rice. The knock down of OsARF1 turned off some key switches for transformation from vegetative stage to the reproductive stage[2]. As an early response gene in auxin signaling, OsARF1 could be associated with embryogenesis and may play a key role in fertility and regulate quite a few downstream genes associated with growth and reproduction[1][2]. Further elucidation of the downstream targets of Os-ARF1 will help to understand the regulation of plant growth by auxin-mediated gene expression[2].

GO assignment(s): GO:0003677, GO:0005634, GO:0006445, GO:0009725, GO:0045449, GO:0046983

Wild Type VS. Mutant

An antisense OsARF1 recombinant plasmid was transformed into rice embryogenic calli through Agrobacterium-mediated transformation by Attia et al and they found that the growth of transgenic rice was inhibited[2].

  • The AS-OsARF1 transformed plants showed significantly lower growth and vigor that included smaller leaves and shorter heights, compared to nontransformed plants. Interestingly, the length of the tillering node didn’t change significantly in transgenic plants (Figure 1). Also, the leaves curled across the width[2].

  • Eight of 11 transgenic plants failed to head and the remaining three were sterile, although they were able to develop to the heading stage 13–15 days later than the non-transformed plants. Hence, no F2 progeny was obtained[2].

Expression

  • RT-PCR Analyses by Attia et al. showed that OsARF1 was transcript accumulated in callus and young panicle at much higher amount than in leaf and root(Figure 2). This indicates that OsARF1 may be associated with embryogenesis, because of the higher transcript abundance in young panicles and calli, which both are embryonic tissues[2].(1.embryogenic callus; 2. differentiating callus; 3. young panicles; 4. leaves;5. roots. Lower lanes: Actin mRNAas a control.)

  • The study by Frank Waller et al. showed that OsARF1 mRNA levels are rapidly induced by auxin[1]. They extracted total RNA from coleoptile segments which had been incubated in different auxin concentrations after depletion of internal auxin. Then they measured the abundance of OsARF1 mRNA in northern blot experiments and found that the highest level of OsARF1 transcript was detected after incubation with either 1 or 3 μM auxin, whereas incubation in 100 μM auxin produced low OsARF1 transcript levels[1]. OsARF1 mRNA steady-state levels therefore follow an optimum curve with a maximum of between 1 and 3 μM auxin[1].

  • Microarray analysis of the transgenic plants by Attia et al. showed that 435 genes were differently expressed, 255 of them were down regulated and 180 were up regulated. The annotated genes were located in 9 sub-categories of molecular functions in gene ontology. Most of the differently expressed genes were categorized among those encoding proteins with catalytic activity[2].

Localization

The study by Frank Waller et al. showed that OsARF1 was localized to the nucleus in vivo[1].

Knowledge Extension

Figure 4. The modular structure of the OsARF family.(from reference) [3].
  • Auxin signaling plays a vital role in plant growth and development processes like, in apical dominance, tropic responses, lateral root formation, vascular differentiation, embryo patterning and shoot elongation[1][2][3][4]. The auxin response factor (ARF) and auxin/indole acetic acid (Aux/IAA) protein families are required for transcriptional regulation of auxin response genes, and they are very important in auxin signalling and plant development[3].

  • An ARF protein contains a DNA-binding domain (DBD) in the N-terminal region, a middle region that functions as an activation domain (AD) or repression domain (RD), and a carboxyl-terminal dimerization domain (CTD) that are similar to those found in the C terminus of Aux/IAAs, which is a protein-protein interaction domain that mediates the homo- and heterodimerization of ARFs and also the hetero-dimerization of ARF and Aux/IAA proteins (Figure 4).[3][4]

  • The ARF proteins are encoded by a large gene family, with 23, 25 and 31 members in Arabidopsis, Rice and Maize respectively. Genetic divergence between Arabidopsis and rice ARF gene family investigated by genome-wide analysis revealed that most of the rice OsARFs and maize ZmARFs are related to Arabidopsis ARFs and fall into sister pairs as in Arabidopsis[4].

Labs working on this gene

  • Institut für Biologie II, Albert-Ludwigs-Universität, Schänzlestrasse 1, 79104 Freiburg
  • Hitachi Advanced Research Laboratory, Hatoyama, Saitama 350-0395
  • Present address: Nara Institute of Science and Technology, 8916-5 Takayama, Ikoma, Nara 630-0101, Japan
  • Rice Biotechnology Lab., Rice Research & Training Center, Sakha, Kafr EL-Sheikh, 33717, Egypt
  • Institute of Genetic Engineering, School of Life Science, Fudan University, Shanghai, 200433, China
  • Plant Biotechnology and Genomics Core-Facility, Department of Plant, Soil, and Agricultural Systems,Southern Illinois University, Carbondale, IL 62901–4415, USA
  • Department of Genetics, Faculty of Agriculture, Alexandria University, Alexandria, Egypt
  • Faculty of Agriculture Research Park (FARP) and Biochemistry Department, Faculty of Agriculture, Cairo University,12613 Giza, Egypt

References

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 Waller F, Furuya M, Nick P. OsARF1, an auxin response factor from rice, is auxin-regulated and classifies as a primary auxin responsive gene[J]. Plant molecular biology, 2002, 50(3): 415-425.
  2. 2.00 2.01 2.02 2.03 2.04 2.05 2.06 2.07 2.08 2.09 2.10 2.11 Attia K A, Abdelkhalik A F, Ammar M H, et al. Antisense phenotypes reveal a functional expression of OsARF1, an auxin response factor, in transgenic rice[J]. Current issues in molecular biology, 2009, 11(1): I29.
  3. 3.0 3.1 3.2 3.3 Shen C J, Wang S K, Bai Y H, et al. Functional analysis of the structural domain of ARF proteins in rice (Oryza sativa L.)[J]. Journal of experimental botany, 2010, 61(14): 3971-3981.
  4. 4.0 4.1 4.2 Xing H, Pudake R, Guo G, et al. Genome-wide identification and expression profiling of auxin response factor (ARF) gene family in maize[J]. BMC genomics, 2011, 12(1): 178.

Structured Information

Gene Name

Os11g0523800

Description

Transcriptional factor B3 family protein

Version

NM_001074520.1 GI:115485688 GeneID:4350610

Length

6288 bp

Definition

Oryza sativa Japonica Group Os11g0523800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 11

Location

Chromosome 11:20763199..20769486

Sequence Coding Region

20763767..20763950,20764042..20764232,20764784..20765727,20765806..20765977,20766055..20766130
,20766221..20766340,20766518..20766682,20766771..20766861,20767396..20767480
,20767596..20767766,20767874..20767930,20768013..20768108,20768946..20769085
,20769187..20769253

Expression

GEO Profiles:Os11g0523800

Genome Context

<gbrowseImage1> name=NC_008404:20763199..20769486 source=RiceChromosome11 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008404:20763199..20769486 source=RiceChromosome11 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgacggcggaggtcggcggcggcggcggtgagggggatgctgctgccgcggcggtggcgcgaggcggcggcggcggaggaggaggaggaggaggggaggacgcgctgttcacggagctgtggagcgcgtgcgcggggccgctggtgacggtgccgagggttggggagaaggtgttctacttcccgcaggggcacatcgagcaggtggaggcctcgaccaaccaggtaggcgagcagcggatgcagttgtacaatctcccatggaagatcctgtgtgaggttatgaacgttgagctgaaggccgagccagacaccgacgaggtttatgctcagctcactctgcttcctgaatcgaagcaacaagaagataacggctctactgaggaggaggtgccttctgctccagcagctgggcatgttaggccacgggtgcactcattctgcaagacattgaccgcctcggacacgagcacacatggcggcttctcggtgctgcgacgccacgcggacgaatgcctcccaccactggatatgagccgtcagcctccaacacaagagctggtggccaaggatctgcacggtgtggaatggcgctttcgtcacatattcagaggtcaaccacgaagacaccttttgcagagtggctggagtgtgtttgttagtgccaaacggcttgttgctggggatgcctttatctttctcagaggtgagaacggggaactgcgtgttggagtcaggcgtgcaatgaggcagcaaactaatgttccatcttcagtgatatcaagccacagcatgcatcttggggttcttgccacagcatggcatgctgttaacacagggaccatgttcactgtctactacaagcctaggacaagtccagccgagtttgtggtcccttacgatcgctatatggaatcactgaaacaaaattactccattgggatgagatttaagatgaggtttgaaggtgaagaggctccagagcaaagattcactgggactattgtcggaatgggggattctgatccagctggctggcctgaatcaaaatggcgctcccttaaggtgagatgggatgaagcttcttccatacctcgccctgaaagagtttctccctggcaaatagaacctgctgtaagccctcctcctgtcaacccactaccagttccaagaaccaagaggcttcgtccgaatgctaccgctttgccggctgactcttctgctatagcaaaagaagctgctacgaaagttgtggtcgagtctgaaccaaatggtacgcaaaggaccttccagacacaagagaatgcaaccccaaaaagtggtttcggcaatagcagcgagttagaaagtgctcagaaatcaatcatgcgtccatctggatttgatcgtgagaaaaataacactcccatacagtggaagctaggttcagatggtcggatgcagatgagcaagcctgagagttacagtgagatgctatctggatttcagccacctaaagatgtacaaatcccacagggtttctgttctttacctgagcagattactgcaggccattctaacttctggcacacagtaaatgctcagtatcaagatcaacagagcaatcacaatatgttccccagctcatggtccttcatgcctccaaatactcgccttggattaaacaaacagaactattcaatgattcaggaagctggtgtgttgtctcaaaggcctggaaatacaaagtttgggaatggagtttatgctgcactgccaggccgaggtactgagcaatactcagggggttggtttggccatatgatgccaaattcccacatggatgatacacagccacgcctgatcaagcctaaacctctggttgttgcccatggtgatgttcagaaagctaaaggtgcttcatgcaaactatttggaattcaccttgacagcccagcgaaatctgaacctttgaaatctccatcaagtgttgtatatgatgggacgccacaaacaccaggtgctactgaatggcgccgaccagatgtaactgaagtagagaaatgttctgatccttctaaggccatgaagccacttgatactccgcaaccagactctgttcctgagaagccttcttctcagcaagcttcacgaaacatgtcgtgcaaatcacaaggtgtatcaactagaagctgcaagaaggtccacaagcaaggcattgcacttggcaggtctgtggaccttacaaagtttaatggctatgaagagttgattgctgagctggatgacatgtttgatttcaatggtgaactgaagggtcctaagaaggagtggatggttgtctacactgacaacgaaggtgacatgatgctagttggggatgatccctggattgaattctgcgacatggttcacaagatcttcatctacacaagagaagaggttcagcggatgaatccgggaaccctgaactcaagatcagaagatagtcatgctaattcaatggaaaggggctcagtcggcagagaaatgcgaggctgcttgtcaacctcgtctcttaattctgagaactgctaa</cdnaseq>

Protein Sequence

<aaseq>MATAEVGGGGGEGDAAAAAVARGGGGGGGGGGGEDALFTELWSA CAGPLVTVPRVGEKVFYFPQGHIEQVEASTNQVGEQRMQLYNLPWKILCEVMNVELKA EPDTDEVYAQLTLLPESKQQEDNGSTEEEVPSAPAAGHVRPRVHSFCKTLTASDTSTH GGFSVLRRHADECLPPLDMSRQPPTQELVAKDLHGVEWRFRHIFRGQPRRHLLQSGWS VFVSAKRLVAGDAFIFLRGENGELRVGVRRAMRQQTNVPSSVISSHSMHLGVLATAWH AVNTGTMFTVYYKPRTSPAEFVVPYDRYMESLKQNYSIGMRFKMRFEGEEAPEQRFTG TIVGMGDSDPAGWPESKWRSLKVRWDEASSIPRPERVSPWQIEPAVSPPPVNPLPVPR TKRLRPNATALPADSSAIAKEAATKVVVESEPNGTQRTFQTQENATPKSGFGNSSELE SAQKSIMRPSGFDREKNNTPIQWKLGSDGRMQMSKPESYSEMLSGFQPPKDVQIPQGF CSLPEQITAGHSNFWHTVNAQYQDQQSNHNMFPSSWSFMPPNTRLGLNKQNYSMIQEA GVLSQRPGNTKFGNGVYAALPGRGTEQYSGGWFGHMMPNSHMDDTQPRLIKPKPLVVA HGDVQKAKGASCKLFGIHLDSPAKSEPLKSPSSVVYDGTPQTPGATEWRRPDVTEVEK CSDPSKAMKPLDTPQPDSVPEKPSSQQASRNMSCKSQGVSTRSCKKVHKQGIALGRSV DLTKFNGYEELIAELDDMFDFNGELKGPKKEWMVVYTDNEGDMMLVGDDPWIEFCDMV HKIFIYTREEVQRMNPGTLNSRSEDSHANSMERGSVGREMRGCLSTSSLNSENC</aaseq>

Gene Sequence

<dnaseqindica>5537..5720#5255..5445#3760..4703#3510..3681#3357..3432#3147..3266#2805..2969#2626..2716#2007..2091#1721..1891#1557..1613#1379..1474#402..541#234..300#gttttttttttcttcttttttctcgcttaaattcacccagtaaaaaaaaaatttaaaacaaaagagaggagaggagaggaagaagaggaggtggtggaggaggaggaggagaagctgcttgtgctgctgctgcgaatcggaggggaattcgagggggcggggggcgcgaatccggcgggggaattcgcgcgattcgggcgtggccgcgggggatgtgaagatctggtggggtgatggcgacggcggaggtcggcggcggcggcggtgagggggatgctgctgccgcggcggtggcgcgaggtgagctcctctcggtggtgggtgggcgtgtgtgggtttgcgcgtgggttttttgtgggctggcttgtgatgccggcttttgggctttgggcttgcagcaggcggcggcggcggaggaggaggaggaggaggggaggacgcgctgttcacggagctgtggagcgcgtgcgcggggccgctggtgacggtgccgagggttggggagaaggtgttctacttcccgcaggggcacatcgagcaggtgagtccgagtccgagctcgaggtcgagcagagcgcgcgccgcccaattcgggcgcggggtggtggcggtggcggcggccgcctttctcgcctctccgcgattccccgctttttattagagagtttattagttccatttcgatttctcttcctggtccttttccgccgtttgattttgagagtttttttggttttcaactctcttttctctctcttcgtgtttctgttgatccgagtggcgtcttcgggtttgagctgttttgaagccactcgttttttttcttcttgacttgttcaaatgcttgaggttttggtgtttatgcgtcctagcggcgatgggaatcttttaagataaattttggggggaatttgtctgtgccgttggcgaatttcgctttcttgagtttgtgtcgtggaattttggcgggttttgagcatttttggtgatgcggttttggggtttacgttttgcctctctaaaattcgaagttttttccaagttttttcggttatactgtatgcaattctctggttcgaactaagtttccgagttgtcgcagttgctgagtgtgagattggaactatttgaatggggaattctgtagtttttgtgccggatcgcttcgcctatgagtcgaattcggcttcttggttgccaaaattcggaattctgtgttttacttcgcaaaagaaaaaaaaactggggattttcgtgcttggtactgaactagtgataatttgttcttcctgcattcttgcaaatgtattttttttcttggctggaatcagtgtttcggtggctgattttggaattctttgcctctgtccattttcaggtggaggcctcgaccaaccaggtaggcgagcagcggatgcagttgtacaatctcccatggaagatcctgtgtgaggttatgaacgttgagctgaaggtacttgctttgtgtttcttgtgaattctgagagctttcattcttggttgtatgtgtggttgacatatagctctgtttgtaggccgagccagacaccgacgaggtttatgctcagctcactctgcttcctgaatcgaaggtaaaaaaaaaaatgtctccagtttgcacgctgtcactgcttcatacattccgggatagaagttttgagcgttttgaaaggaaaaaaaatgttggtctgttgtgtagcaacaagaagataacggctctactgaggaggaggtgccttctgctccagcagctgggcatgttaggccacgggtgcactcattctgcaagacattgaccgcctcggacacgagcacacatggcggcttctcggtgctgcgacgccacgcggacgaatgcctcccaccactggttcgtcccactggttctttgacttgatgttgttttcagtgatgtacttgtagtcctaggtcttactaggatgcttgagttgtagtgatgatctttgctttggcttcttgatcaggatatgagccgtcagcctccaacacaagagctggtggccaaggatctgcacggtgtggaatggcgctttcgtcacatattcagaggtgatcactcttccaacatcgtacttatttctctattttctgaaggacgtgtgatgctcactgctctttgctaatgaacacaagtttccatgatatcatgactaggagacatctttacactgctcttgggttgatcgtatagtgtaagaacagttcttgcatttgactaaccccttcatttataatattggtattaaatgcacttttttggtacgatgcctatcccgtattatcttgatggctttattagagggaccagtttgtgcttcccacaatttcttgtgcatttttgttctttgcatgggcctacacttgatggagtatggataactacaacttttgttggttgatgctgcagtggtcgtgctctagtttcttaggacaagtagtttatgctttcatatgcccttgtgatgtaagagttgtgctaattgattatgttgtcctgcccgagtttcgattgcacctaggttagaaggaagttaattttttgcttcaactcttcttgagctatatctttttgatcaacatcaggtcaaccacgaagacaccttttgcagagtggctggagtgtgtttgttagtgccaaacggcttgttgctggggatgcctttatctttctcaggtttgataatttgacacagtgtttgctttgtctacctgtgctttcccctgtactgcttaataaatatccccctatatgatctgcacagaggtgagaacggggaactgcgtgttggagtcaggcgtgcaatgaggcagcaaactaatgttccatcttcagtgatatcaagccacagcatgcatcttggggttcttgccacagcatggcatgctgttaacacagggaccatgttcactgtctactacaagcctaggtttgttgtgaagtttttctggattttatgcacatgattttatttatgcactttgggagcattgtctgtttacttgtcacctgaattctgaactgatcttgctatgtgatagaattaaatttgtccgattgtgctagcacttaaacgctatcgctgaaatcttctatttttcatcaggacaagtccagccgagtttgtggtcccttacgatcgctatatggaatcactgaaacaaaattactccattgggatgagatttaagatgaggtttgaaggtgaagaggctccagagcaaaggtagcacttagatggatatgcattctacttttgacaggtgattcctctgtatctgaatcaaccgattaatctttaatgctcatgcattagattcactgggactattgtcggaatgggggattctgatccagctggctggcctgaatcaaaatggcgctcccttaaggtttatttctttcgccactttccatttaaataacatttattttctgagaatttcttacagatttttgtgttacttaggtgagatgggatgaagcttcttccatacctcgccctgaaagagtttctccctggcaaatagaacctgctgtaagccctcctcctgtcaacccactaccagttccaagaaccaagaggcttcgtccgaatgctaccgctttgccggctgactcttctgctatagcaaaagaaggtcagaccttgtcatcaatatgaaatctacagtatagcttcgttgtctttactaatgcacgtcttttcttcaatctagctgctacgaaagttgtggtcgagtctgaaccaaatggtacgcaaaggaccttccagacacaagagaatgcaaccccaaaaagtggtttcggcaatagcagcgagttagaaagtgctcagaaatcaatcatgcgtccatctggatttgatcgtgagaaaaataacactcccatacagtggaagctaggttcagatggtcggatgcagatgagcaagcctgagagttacagtgagatgctatctggatttcagccacctaaagatgtacaaatcccacagggtttctgttctttacctgagcagattactgcaggccattctaacttctggcacacagtaaatgctcagtatcaagatcaacagagcaatcacaatatgttccccagctcatggtccttcatgcctccaaatactcgccttggattaaacaaacagaactattcaatgattcaggaagctggtgtgttgtctcaaaggcctggaaatacaaagtttgggaatggagtttatgctgcactgccaggccgaggtactgagcaatactcagggggttggtttggccatatgatgccaaattcccacatggatgatacacagccacgcctgatcaagcctaaacctctggttgttgcccatggtgatgttcagaaagctaaaggtgcttcatgcaaactatttggaattcaccttgacagcccagcgaaatctgaacctttgaaatctccatcaagtgttgtatatgatgggacgccacaaacaccaggtgctactgaatggcgccgaccagatgtaactgaagtagagaaatgttctgatccttctaaggccatgaagccacttgatactccgcaaccagactctgttcctgagaagccttcttctcagcaagcttcacgaaacatgtcgtgcaaatcacaaggtgtatcaactagaagctgcaagaaggtaccactttcttgttattattgcacttatcacctctttgcaatctccaagttcttccttgtgaatgattttaaataattctccaacaagttttcctcccctcctagatatgcccaataagattaattttggagcacctttggatatacttcctccgtttcatattataagactttctagcattgcccacattcatatatatatatatgttaataaatctagacatatatgtgtgcctatattctttaacatctatatgaatgtaggcaatgctagaaagtcttataacctgaaacggaggtagtattatatttcaaaggtccaaatgtacaaacttgctcagtatttttttttgccaaagttaatatagctcaactcattctctaatctctcctatagatgcataatcaaacccttgtttcttacatataatctttccttcggaagcatgtttggcactacttataccatcctcaagtgctcagcttaattattttttctagattttccctgttttccaacatgatggttgataaactatacatttccaggtccacaagcaaggcattgcacttggcaggtctgtggaccttacaaagtttaatggctatgaagagttgattgctgagctggatgacatgtttgatttcaatggtgaactgaagggtcctaagaaggagtggatggttgtctacactgacaacgaaggtgacatgatgctagttggggatgatccctggatgtgagttaactcataaatgctttcctcattcgctgatctgatttaatgacatcacaaatgctgactgcatcggacaatcattcttgaacagtgaattctgcgacatggttcacaagatcttcatctacacaagagaagaggttcagcggatgaatccgggaaccctgaactcaagatcagaagatagtcatgctaattcaatggaaaggggctcagtcggcagagaaatgcgaggctgcttgtcaacctcgtctcttaattctgagaactgctaatgctttcccatctggtaacgtgagtagtggcatttcacctttcttcactataactagtaaagtataaacggcctccggtgctcatctttgttccatcatcttgctttctggcaggtcttttgaagtaacatgggagacaagaacgcgatgcatcgttataagaaaatgcatttcgtagtggagttaatgctttttttccccctttgatgtattggataagctcaaagtaccctatttgtagatggtgcttgtccttggtggtcaagttgcactcttatttgctgcagttttggttttctattttggtgaggtaagttgtcagccgccagtcctaccatataaatgttggtatgcgtagaaaagtaagctcagccctcccaccctgcacttcctctctctcagcactaagctgccacctccttgtaaatagcccctgtttaattgagtctaatatattatctaccttaactgacattcctttgtttcatcttgctaaattatagcagtagcctggtaagattattgtagcccaaattaacatgtgatctgagattttatttttgctttc</dnaseqindica>

External Link(s)

NCBI Gene:Os11g0523800, RefSeq:Os11g0523800