Difference between revisions of "Os09g0363900"

From RiceWiki
Jump to: navigation, search
Line 6: Line 6:
  
 
===Expression===
 
===Expression===
ONI3 was expressed in shoots and developing embryos but not in leaves, roots or calli. To be more specific, ONI3 was expressed in the outermost cell layer of the SAM, young leaf and floral organs.In the embryo 7 days after pollination (DAP), ONI3 expression was detected in shoot organs such as the SAM,leaves and coleoptile. In the vegetative growth phase, at 1 month after germination, ONI3 expression was detected specifically in the outermost cell layer of the SAM and young leaves. In the reproductive growth phase, ONI3 expression was detected again in the outermost cell layer of developing floral organs. In the ovary, ONI3 expression was detected in the outermost cell layer of the ovary and ovule. Integuments also showed the expression. No signal was detected in the inner cells of any organs or at any developmental stages examined. These expression analyses revealed that ONI3 is an outermost cell layer-specific gene of the SAM and young above-ground organs throughout the life cycle.<ref name="ref1" /><ref name="ref3" />
+
ONI3 was expressed in shoots and developing embryos but not in leaves, roots or calli. To be more specific, ONI3 was expressed in the outermost cell layer of the SAM, young leaf and floral organs.In the embryo 7 days after pollination (DAP), ONI3 expression was detected in shoot organs such as the SAM,leaves and coleoptile. In the vegetative growth phase, at 1 month after germination, ONI3 expression was detected specifically in the outermost cell layer of the SAM and young leaves. In the reproductive growth phase, ONI3 expression was detected again in the outermost cell layer of developing floral organs. In the ovary, ONI3 expression was detected in the outermost cell layer of the ovary and ovule. Integuments also showed the expression. No signal was detected in the inner cells of any organs or at any developmental stages examined. These expression analyses revealed that ONI3 is an outermost cell layer-specific gene of the SAM and young above-ground organs throughout the life cycle.<ref name="ref1" />
  
 
===Evolution===
 
===Evolution===
 
ONI3 encodes a protein similar to Arabidopsis HTH. HTH encodes an enzyme similar to long-chain fatty acid (LCFA) o-alcohol dehydrogenases, and was shown to be involved in biosynthesis of long-chain a-, o-dicarboxylic fatty acids. Since ONI3 and HTH showed high sequence identity (56% identity in
 
ONI3 encodes a protein similar to Arabidopsis HTH. HTH encodes an enzyme similar to long-chain fatty acid (LCFA) o-alcohol dehydrogenases, and was shown to be involved in biosynthesis of long-chain a-, o-dicarboxylic fatty acids. Since ONI3 and HTH showed high sequence identity (56% identity in
their entire amino acid sequences) and was categorized into the same clade in a phylogenetic tree, ONI3 also seemed to encode LCFA o-alcohol dehydrogenase and plays a role in biosynthesis of long-chain a-, o-dicarboxylic fatty acids, but this remains to be characterized biochemically.<ref name="ref2" />
+
their entire amino acid sequences) and was categorized into the same clade in a phylogenetic tree, ONI3 also seemed to encode LCFA o-alcohol dehydrogenase and plays a role in biosynthesis of long-chain a-, o-dicarboxylic fatty acids, but this remains to be characterized biochemically.
  
A database search identified six homologs of ONI3 in the rice genome. Among them, Os08g0401500 was most similar to ONI3, and was categorized into the same clade that includes HTH. The amino acid sequences of ONI3 and Os08g0401500 were 72% identical to each other. ONI3 showed 32–50% amino acid identities with the remaining five homologs.<ref name="ref4" />
+
A database search identified six homologs of ONI3 in the rice genome. Among them, Os08g0401500 was most similar to ONI3, and was categorized into the same clade that includes HTH. The amino acid sequences of ONI3 and Os08g0401500 were 72% identical to each other. ONI3 showed 32–50% amino acid identities with the remaining five homologs.<ref name="ref1" />
  
  
Line 24: Line 24:
 
<references>
 
<references>
 
<ref name="ref1">Akiba T, Hibara K, Kimura F, Tsuda K, Shibata K, Ishibashi M, Moriya C, Nakagawa K, Kurata N, Itoh J, Ito Y. (2014)  Organ fusion and defective shoot development in oni3 mutants of rice.Plant Cell Physiol. 55(1): 42–51</ref>
 
<ref name="ref1">Akiba T, Hibara K, Kimura F, Tsuda K, Shibata K, Ishibashi M, Moriya C, Nakagawa K, Kurata N, Itoh J, Ito Y. (2014)  Organ fusion and defective shoot development in oni3 mutants of rice.Plant Cell Physiol. 55(1): 42–51</ref>
<ref name="ref2">Krolikowski, K.A., Victor, J.L., Wagler, T.N., Lolle, S.J. and Pruitt, R.E.(2003) Isolation and characterization of the Arabidopsis organ fusion gene HOTHEAD. Plant J. 35: 501–511.</ref>
 
<ref name="ref3">Fujita, M., Horiuchi, Y., Ueda, Y., Mizuta, Y., Kubo, T., Yano, K. et al.(2010) Rice expression atlas in reproductive development. Plant Cell Physiol. 51: 2060–2081.</ref>
 
<ref name="ref4">Kurdyukov, S., Faust, A., Trenkamp, S., Bar, S., Franke, R., Efremova, N. et al. (2006) Genetic and biochemical evidence for involvement of HOTHEAD in the biosynthesis of long-chain a-, o-dicarboxylic fatty acids and formation of extracellular matrix. Planta 224: 315–329.</ref>
 
 
 
 
 
  
  

Revision as of 17:25, 7 May 2014

Please input one-sentence summary here.

Annotated Information

Function

Os09g0363900,also called "ONI3(or ONION3)",which is required for avoiding organ fusions in rice.Loss of function mutations of ONI3 showed abnormal organ fusions in developing shoots. The mutant seedlings showed fusions between neighboring organs and also within an organ; they stopped growing soon after germination and subsequently died. ONI3 encodes a putative o-alcohol dehydrogenase that is necessary for shoot development in rice. In spite of the outermost cell layer-specific expression of ONI3 in shoot apex, the effects of the oni3 mutation were not restricted to the outermost cells and oni3 did not show a simply epidermis-affected phenotype, but they were expanded to the entire shoot and oni3 produced a very small shoot. Thus, cell fate and/or function in the inner layers was suggested to be controlled non-cell autonomously by intercellular signaling from the epidermis.[1]

Expression

ONI3 was expressed in shoots and developing embryos but not in leaves, roots or calli. To be more specific, ONI3 was expressed in the outermost cell layer of the SAM, young leaf and floral organs.In the embryo 7 days after pollination (DAP), ONI3 expression was detected in shoot organs such as the SAM,leaves and coleoptile. In the vegetative growth phase, at 1 month after germination, ONI3 expression was detected specifically in the outermost cell layer of the SAM and young leaves. In the reproductive growth phase, ONI3 expression was detected again in the outermost cell layer of developing floral organs. In the ovary, ONI3 expression was detected in the outermost cell layer of the ovary and ovule. Integuments also showed the expression. No signal was detected in the inner cells of any organs or at any developmental stages examined. These expression analyses revealed that ONI3 is an outermost cell layer-specific gene of the SAM and young above-ground organs throughout the life cycle.[1]

Evolution

ONI3 encodes a protein similar to Arabidopsis HTH. HTH encodes an enzyme similar to long-chain fatty acid (LCFA) o-alcohol dehydrogenases, and was shown to be involved in biosynthesis of long-chain a-, o-dicarboxylic fatty acids. Since ONI3 and HTH showed high sequence identity (56% identity in their entire amino acid sequences) and was categorized into the same clade in a phylogenetic tree, ONI3 also seemed to encode LCFA o-alcohol dehydrogenase and plays a role in biosynthesis of long-chain a-, o-dicarboxylic fatty acids, but this remains to be characterized biochemically.

A database search identified six homologs of ONI3 in the rice genome. Among them, Os08g0401500 was most similar to ONI3, and was categorized into the same clade that includes HTH. The amino acid sequences of ONI3 and Os08g0401500 were 72% identical to each other. ONI3 showed 32–50% amino acid identities with the remaining five homologs.[1]


You can also add sub-section(s) at will.

Labs working on this gene

Graduate School of Agricultural Science, Tohoku University, Sendai, 981-8555 Japan

References

<references> [1]


Structured Information

Gene Name

Os09g0363900

Description

Similar to HOTHEAD protein precursor (ADHESION OF CALYX EDGES protein)

Version

NM_001069531.1 GI:115478804 GeneID:4346864

Length

5043 bp

Definition

Oryza sativa Japonica Group Os09g0363900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 9

Location

Chromosome 9:12525599..12530641

Sequence Coding Region

12525764..12525818,12525923..12526494,12526947..12527335,12527480..12527793,12529490..12529844
,12530466..12530538

Expression

GEO Profiles:Os09g0363900

Genome Context

<gbrowseImage1> name=NC_008402:12525599..12530641 source=RiceChromosome09 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008402:12525599..12530641 source=RiceChromosome09 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggctttgagcaagagaatgctattcatcttccaggccatggtttgcctctgctccttcagtttatcccaaggcaaccagcaattcagcttaaggaatctccctaccctccagaaggcgagcagcttcccagcgatgcgccacgagacatacgactacattgtcgtcggcgggggcaccgccggttgccccctggcggcgacattgtcgctcaagtacaaggtgctcctgctggagaggggagggtctccgtatggcaaccgcaacgtctcctacatggagaacttccacattggcctgagcaatatggcgccggactcggcgtctcaggccttcatctccactgacggcgtcatcaatgcccgagcgagggtgttgggaggtggcacctgcatcaatgccggcttctacagccgggccagctcaaacttcatccaggaggtaggctgggatgaagacctggtgaatgagtccttcccttgggtggaggacaagatcgtccagtggcctaagatcgcaccttggcaggctgcactaagggatgggctactccaagcaggtgtatctcctttcaatggctacacatatgaccatgtttctgggaccaaagttggtggcaccatctttgatgagactggctaccgccacacagcagccgacttacttgcagctggagaccctaacaacctaagggtgctgcttcatgctagtgtgaacaggatagtctttaactcgcagagagggcaactgaagccaagagcaaccggagttcagttcaccgatgagaatggaggactccaccaggcattcctcaacagcaactgtgatagtgaaatcattgtctctgctggcgcaattggcagcccccagctgctattgctcagtgggattggacccaagaatgaccttaggagccataaaattcctgtagttctccataacaagtatgtgggtaaagggatggctgataaccccatgaactccatattcataccgacgaaaagcccccctcgccagtccctgattgagactgttggaataactgaagctggtgtgttcattgaggccagtagtggttttggccagtcaccagaaagcatccattgccaccatggaatcatgtccgctgagattggacagctgtccacaattcctccgaaggaaagaagcctggaaaaagcacagaagtatgcaaataccaaacttaatctacccaaagagatattccatggtggttttatcctcgagaagattgatggtccactgtctacgggacatcttgccctgatagacactgatgtcaagaagaaccctgcggttaccttcaactacttcagtcatccacaggatctcactcgttgcgtctatggtatcaagaccattgaacgaatactgaagacaaaccgtttctctgaactgtctgccaacactgatggacattcaatggaaagagtgctcaatatgagtgtgcaggctaatgtgaacttgatacccaagcatacaaatgacacagaatccctagagcaattttgcagggatacagtaataaccatctggcactaccatggtggatgccatgtagggaaggtggttgatcagcaacaccgtgtgcttggagtttcaggcgtccgtgtagtcgatggctcaacattttctagatcaccagggacgaaccctcaagccacggtcatgatgatgggcagatattttggagtgatgatcctaaggggaagactaggtcgagcagctggagtgtaa</cdnaseq>

Protein Sequence

<aaseq>MALSKRMLFIFQAMVCLCSFSLSQGNQQFSLRNLPTLQKASSFP AMRHETYDYIVVGGGTAGCPLAATLSLKYKVLLLERGGSPYGNRNVSYMENFHIGLSN MAPDSASQAFISTDGVINARARVLGGGTCINAGFYSRASSNFIQEVGWDEDLVNESFP WVEDKIVQWPKIAPWQAALRDGLLQAGVSPFNGYTYDHVSGTKVGGTIFDETGYRHTA ADLLAAGDPNNLRVLLHASVNRIVFNSQRGQLKPRATGVQFTDENGGLHQAFLNSNCD SEIIVSAGAIGSPQLLLLSGIGPKNDLRSHKIPVVLHNKYVGKGMADNPMNSIFIPTK SPPRQSLIETVGITEAGVFIEASSGFGQSPESIHCHHGIMSAEIGQLSTIPPKERSLE KAQKYANTKLNLPKEIFHGGFILEKIDGPLSTGHLALIDTDVKKNPAVTFNYFSHPQD LTRCVYGIKTIERILKTNRFSELSANTDGHSMERVLNMSVQANVNLIPKHTNDTESLE QFCRDTVITIWHYHGGCHVGKVVDQQHRVLGVSGVRVVDGSTFSRSPGTNPQATVMMM GRYFGVMILRGRLGRAAGV</aaseq>

Gene Sequence

<dnaseqindica>4824..4878#4148..4719#3307..3695#2849..3162#798..1152#104..176#aggaaacaggggagggagagaggttttgccaccgttgttttggagggaaggaaaatcctaagaaggggaaagagtttagcttggcaggtggttctcaggctcaatggctttgagcaagagaatgctattcatcttccaggccatggtttgcctctgctccttcagtttatcccaaggtgcgcatctcttgtggttctgtctcatctcatgtttctcaggcattcctcctctattctgtattctgtctcatctcatgtttctcaggcattcctcctttattctgtacatttctgttccaccttcccattgaagaacttgcaatggtgaaatgcagttatatatgctagtttttgcttagcttctttctcgcaagaatatcattatcacgtgcacttccattatctgacactttggttcctatcattgtttatcgccacattggcctcaccactagtatttgagagtagcagaacatctaatcattcagagttcaatatttagagattgaaggataggaaataaatagtcaacacaatgccacaagacgtacctctcatccagtcctaggaggtacaatgccaactgccaagaggtccagaccctagtaatcatagcatcaattagattgatacactcatttatcaacatgcaaaaacaggttatgtttttagataatgaaagcttttattgaagtcatgcaaaaaaaaaaagggggttatagcatgagaaacttacagcagaacaaagcaaaactttttcaggcaatgacaacattatggaacactttgttttctcaggcaaccagcaattcagcttaaggaatctccctaccctccagaaggcgagcagcttcccagcgatgcgccacgagacatacgactacattgtcgtcggcgggggcaccgccggttgccccctggcggcgacattgtcgctcaagtacaaggtgctcctgctggagaggggagggtctccgtatggcaaccgcaacgtctcctacatggagaacttccacattggcctgagcaatatggcgccggactcggcgtctcaggccttcatctccactgacggcgtcatcaatgcccgagcgagggtgttgggaggtggcacctgcatcaatgccggcttctacagccgggccagctcaaagtaagcaattgcattgcacagatatggatgctatcttgtgtatcagtattcttacctgattatgattgttctcttccgtctacgagtgaccagccaagagagttcacagttcacacatgcaaatttaaccttttttttactgccgaagtgcagaatggtcagcattaatatatacacacaaacatatgcaagagaattcacagttcacacatgcaaatttaacctttttttttactgccgaagtgcagaatggtctcaatcatgatcaagacttcagatataatttactattatattctttaccataagagggcaagcacaaatagcagagcctaaaatgaagttagcataagtagattaaatataccaagtagtctctcagtatatgcaacacatggcctatcactttcacatgaacaaacatcagctctagggtaaatgcagagcagtgatagtgccagtagaaattactaatggtaactggtaagatctgcttgactgctgccaccctagcatactgcagccacctttgttcacccttcaagtggagtaatagctgtctgctgaaacgtgcagcagaacactaaatattattcactgttctcaatagtagcattcaattaccatgaaaccaaagtttctgccaattaggattctctggctacaacctcttgtttcttttctccagcgtccaaatggaaaagggaaaacggggaaacaaacaaacactaattagtgtagctcaaataggttctaatcgactaaaatgagccagccaaaagacacaaatgcataaaaccaccacctgcattactagcactcactctagaacgtacccagcactgcatttggacatgattatcggttcactaggactacatattttggttggtatgattctagacttctagtttatggttatcaaaatgcaggctttctttgagatttatcacaatgcagctctgcaatatataacgaaataaaatccagctgtaaaattagcaaaggttgtactttgagtgcttgcatacaaatgagcactagtgagaaagttgataacataaagaaaataagcagattgcaaaagtggtttgcattaaagtgcttcagtctggtattgcaaataattaactacgctggcagcagcacatgctgtggttttctcagtgaataaaaagacttccttgctcttcttgcagtcatgaactacatgttactgaaacagactagattgaaaagagacattgatgaaaaaaaaaaagagagagacaacaaaacaaaatcacatggggctataattgtttctttgcagtcatggtaactaagttgtctaggcaaaggacactaaataactaaaaccctagtagactcgaggctacttcaagtttgggccaattagtacatatgcattcgaattatttgtacagaatcgaattacaataggtcaatgggtgggccccacacacccgtgctcatcagtcatccctagtgatatacctgctcattaccagaaacgccaatgtgacttaaaaggtatcaataattgataagcttaatcccgtagtcttcaagaaggaattttacttctatattgatattcatattggtgaactacatgttaaattgttattggtgaactacatgttaaattgctaataacttgtataccatgtgtttttgttcttgaaacaaacagcttcatccaggaggtaggctgggatgaagacctggtgaatgagtccttcccttgggtggaggacaagatcgtccagtggcctaagatcgcaccttggcaggctgcactaagggatgggctactccaagcaggtgtatctcctttcaatggctacacatatgaccatgtttctgggaccaaagttggtggcaccatctttgatgagactggctaccgccacacagcagccgacttacttgcagctggagaccctaacaacctaagggtgctgcttcatgctagtgtgaacaggatagtctttaactcgcagagaggtaaataattacacatgtgtggccaaagctcctacaagttgtattatcttctaaaatagagttatatagaattatatgccatgaatagaaagagtaagttcagtaatcacgtaccatatttcagatacaccatttctgatgcagggcaactgaagccaagagcaaccggagttcagttcaccgatgagaatggaggactccaccaggcattcctcaacagcaactgtgatagtgaaatcattgtctctgctggcgcaattggcagcccccagctgctattgctcagtgggattggacccaagaatgaccttaggagccataaaattcctgtagttctccataacaagtatgtgggtaaagggatggctgataaccccatgaactccatattcataccgacgaaaagcccccctcgccagtccctgattgagactgttggaataactgaagctggtgtgttcattgaggccagtagtggttttggccagtcaccagaaagcatccattgccaccatggaatcatgtccgctgaggtatgtcatcaatcttacttgcatcatgagaagctttttgtgcataaaataggtctaaagcagtatcacaaacatcaggaaaaagctgctgcttagatctgcagacttcaaaaaggaaaacagattctaaagtctaaactatcaaaactcacattttgcaacattgcaaacacaacttagaccaattcattaattacaggtgaatatgcatatgcatataatagtatattctaagaaataatacttatctgatttataagtcattgttttatgcttagattttctaggaatcagatctcagaattgaacttcttgtcttggagattaaaaaaaataagtgttgtctacattgcaacaactccaataactgccatcatagtttccattgttgtctcaatttgttccctacttggccttgttggtctaatacatattatattcctatggtacagattggacagctgtccacaattcctccgaaggaaagaagcctggaaaaagcacagaagtatgcaaataccaaacttaatctacccaaagagatattccatggtggttttatcctcgagaagattgatggtccactgtctacgggacatcttgccctgatagacactgatgtcaagaagaaccctgcggttaccttcaactacttcagtcatccacaggatctcactcgttgcgtctatggtatcaagaccattgaacgaatactgaagacaaaccgtttctctgaactgtctgccaacactgatggacattcaatggaaagagtgctcaatatgagtgtgcaggctaatgtgaacttgatacccaagcatacaaatgacacagaatccctagagcaattttgcagggatacagtaataaccatctggcactaccatggtggatgccatgtagggaaggtggttgatcagcaacaccgtgtgcttggagtttcaggcgtccgtgtagtcgatggctcaacattttctagatcaccagggacgaaccctcaagccacggtcatgatgatgggcaggtacataaacacagtaaaaaattaacttctttagtctttacctaatgatattctaactttaaactcttaaagactaaattgcttccctcatatttcatactcagatattttggagtgatgatcctaaggggaagactaggtcgagcagctggagtgtaatcgattcctggacaccagccttttgttatgtgtgacctagagaagaaaaattactaattattgctgggatctagtgtgattcaccgaagaaagacaagctaggagtttcatctgtacccagtaatcatttgtgtcatgtgatattgcagatcaaatggtttattg</dnaseqindica>

External Link(s)

NCBI Gene:Os09g0363900, RefSeq:Os09g0363900

  1. 1.0 1.1 1.2 1.3 Akiba T, Hibara K, Kimura F, Tsuda K, Shibata K, Ishibashi M, Moriya C, Nakagawa K, Kurata N, Itoh J, Ito Y. (2014) Organ fusion and defective shoot development in oni3 mutants of rice.Plant Cell Physiol. 55(1): 42–51