Difference between revisions of "Os06g0610300"
Yonglejiang (talk | contribs) (→Function) |
Yonglejiang (talk | contribs) (→Expression) |
||
| Line 5: | Line 5: | ||
The '''''MOC1''''' gene plays an important role in the control of rice tillering, encoding a putative '''''GRAS''''' family nuclear protein that is expressed mainly in the axillary buds and functions to initiate axillary buds and to promote their outgrowth<ref name="ref1" /><ref name="ref2" />. In the case of the rice plant, more tillering equates to more grain-bearing branches, hence a higher grain yield. Besides, as an member of the plant-specific GRAS family proteins that function in diverse aspects of plant development, including signal transduction, meristem maintenance and development<ref name="ref3" /><ref name="ref4" />, and as transcription factors <ref name="ref5" />,''''' MOC1''''' might also function as a transcription factor<ref name="ref1" />. '''''MOC1''''' is highly homologous with the tomato Lateral suppressor (Ls) gene<ref name="ref1" />. '''''Ls''''' loss-of-function mutations cause a branchless phenotype owing to a failure in axillary meristem initiation<ref name="ref6" />. These results suggest that both '''''Ls''''' and '''''MOC1''''' function as positive regulators of lateral branching. | The '''''MOC1''''' gene plays an important role in the control of rice tillering, encoding a putative '''''GRAS''''' family nuclear protein that is expressed mainly in the axillary buds and functions to initiate axillary buds and to promote their outgrowth<ref name="ref1" /><ref name="ref2" />. In the case of the rice plant, more tillering equates to more grain-bearing branches, hence a higher grain yield. Besides, as an member of the plant-specific GRAS family proteins that function in diverse aspects of plant development, including signal transduction, meristem maintenance and development<ref name="ref3" /><ref name="ref4" />, and as transcription factors <ref name="ref5" />,''''' MOC1''''' might also function as a transcription factor<ref name="ref1" />. '''''MOC1''''' is highly homologous with the tomato Lateral suppressor (Ls) gene<ref name="ref1" />. '''''Ls''''' loss-of-function mutations cause a branchless phenotype owing to a failure in axillary meristem initiation<ref name="ref6" />. These results suggest that both '''''Ls''''' and '''''MOC1''''' function as positive regulators of lateral branching. | ||
| − | ===Expression=== | + | ===Expression== |
| − | + | To identify genes involved in the control of rice tillering, Li et al. have screened for mutants with altered tiller numbers from collections derived from spontaneous mutations or g-ray radiation and ethyl methanesulphonate (EMS) mutagenesis, and they found that moc1 plants nearly completely lose their tillering ability after a spontaneous moc1 mutant, producing only one main culm, in contrast to the multiple tillers in wild-type plants<ref name="ref1" />. They amplified the corresponding ORF from moc1 and wild-type plants with polymerase chain reaction (PCR) and sequenced it. DNA sequence comparison revealed a 1.9-kb retrotransposon inserted in this ORF in the moc1 mutant. Confirmation of the retrotransposon-interrupted ORF as MOC1 was achieved by functional complementation<ref name="ref1" />. Genetic analysis with reciprocal crosses between moc1 and wild-type plants revealed that moc1 possesses a recessive mutation in a single nuclear locus<ref name="ref1" />. | |
| + | We can see the effects of moc1 mutant on rice tillering from the following picture 2. | ||
===Evolution=== | ===Evolution=== | ||
Revision as of 08:07, 11 May 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
The MOC1 gene plays an important role in the control of rice tillering, encoding a putative GRAS family nuclear protein that is expressed mainly in the axillary buds and functions to initiate axillary buds and to promote their outgrowth[1][2]. In the case of the rice plant, more tillering equates to more grain-bearing branches, hence a higher grain yield. Besides, as an member of the plant-specific GRAS family proteins that function in diverse aspects of plant development, including signal transduction, meristem maintenance and development[3][4], and as transcription factors [5], MOC1 might also function as a transcription factor[1]. MOC1 is highly homologous with the tomato Lateral suppressor (Ls) gene[1]. Ls loss-of-function mutations cause a branchless phenotype owing to a failure in axillary meristem initiation[6]. These results suggest that both Ls and MOC1 function as positive regulators of lateral branching.
=Expression
To identify genes involved in the control of rice tillering, Li et al. have screened for mutants with altered tiller numbers from collections derived from spontaneous mutations or g-ray radiation and ethyl methanesulphonate (EMS) mutagenesis, and they found that moc1 plants nearly completely lose their tillering ability after a spontaneous moc1 mutant, producing only one main culm, in contrast to the multiple tillers in wild-type plants[1]. They amplified the corresponding ORF from moc1 and wild-type plants with polymerase chain reaction (PCR) and sequenced it. DNA sequence comparison revealed a 1.9-kb retrotransposon inserted in this ORF in the moc1 mutant. Confirmation of the retrotransposon-interrupted ORF as MOC1 was achieved by functional complementation[1]. Genetic analysis with reciprocal crosses between moc1 and wild-type plants revealed that moc1 possesses a recessive mutation in a single nuclear locus[1]. We can see the effects of moc1 mutant on rice tillering from the following picture 2.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Structured Information
| Gene Name |
Os06g0610300 |
|---|---|
| Description |
Conserved hypothetical protein |
| Version |
NM_001064587.1 GI:115468905 GeneID:4341506 |
| Length |
626 bp |
| Definition |
Oryza sativa Japonica Group Os06g0610300, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 6:25189473..25190098 |
| Sequence Coding Region |
25189730..25189909 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008399:25189473..25190098 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008399:25189473..25190098 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgcaatgtgaaacactgacacagctagaccaggtgtggggggtgtgcttgttcttgttgcaaggaagttatctggaggccatcatcaatgaagatcccaccaagggacaaaacatgagatggttggagacttgggtctgtctagtctctattcaaccatttaaagcattgcgtgtgtag</cdnaseq> |
| Protein Sequence |
<aaseq>MQCETLTQLDQVWGVCLFLLQGSYLEAIINEDPTKGQNMRWLET WVCLVSIQPFKALRV</aaseq> |
| Gene Sequence |
<dnaseqindica>258..437#attcactcatgagttaaaattttactcggagttaaattttaactcatgatgacgtaaacgaatctcggacgtccatttctcgatccaatggtagttttcaagttttcactacatatgtggtttgtactgtatattttcccttgcatctccatgtatctcaaaagttacatgagtggcacttgctactgtgcatgtagtatgtgtagcagctaggttataaatttctttatgtgtaacatgtgtgtgatgcatagtatatgcaatgtgaaacactgacacagctagaccaggtgtggggggtgtgcttgttcttgttgcaaggaagttatctggaggccatcatcaatgaagatcccaccaagggacaaaacatgagatggttggagacttgggtctgtctagtctctattcaaccatttaaagcattgcgtgtgtaggctacactcggagagagaacacagagcagccgtccaaaccgtctgaaatgataacttactctaagctagtaggagtgctagtagtaccctctatatgtgcaattttattcgttaaaaaggtttccatgcatgcttttttagtttatcaatagcctaaaccttttgaattattaagagttaattagtccc</dnaseqindica> |
| External Link(s) |
- ↑ 1.0 1.1 1.2 1.3 1.4 1.5 Cite error: Invalid
<ref>tag; no text was provided for refs namedref1 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref2 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref3 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref4 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref5 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref6