Difference between revisions of "Os02g0771400"

From RiceWiki
Jump to: navigation, search
(→‎Labs working on this gene)
m (Reverted edits by Xialin (talk) to last revision by 124.16.129.48)
Line 1: Line 1:
−
Protein Tyrosine Phosphatase
+
Please input one-sentence summary here.
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
−
OsPFA-DSP2 act as negative regulators of the pathogen response in transgenic plants.Ectopic overexpression of OsPFA-DSP2 in rice increased sensitivity to Magnaporthe grisea (M. grisea Z1 strain), inhibited the accumulation of hydrogen peroxide (H2O2) and suppressed the expression of pathogenesis-related (PR) genes after fungal infection.
+
Please input function information here.
  
 
===Expression===
 
===Expression===
−
OsPFA-DSP2 was mainly expressed in calli, seedlings, roots, and young panicles, and localized in cytoplasm and nucleus.
+
Please input expression information here.
  
 
===Evolution===
 
===Evolution===
 +
Please input evolution information here.
  
−
AtPFA-DSP4,which is homologous to OsPFA-DSP2,overexpressing in transgenic Arabidopsis plants,also exhibited sensitivity to
+
You can also add sub-section(s) at will.
−
Pseudomonas syringae pv. tomato DC3000 (Pst DC3000), reduced accumulation of H2O2 and decreased photosynthesic capacity after infection compared with Col-0.OsPFA-DSP2 and AtPFA-DSP4 act as negative regulators of the pathogen response in transgenic plants.
 
−
 
 
−
===Gene Ontology Classification ===
 
−
{| class='wikitable' style="text-align:center"
 
−
|-
 
−
! | GO accession
 
−
! | Type
 
−
! | Name
 
−
! | Code
 
−
! | With
 
−
|-
 
−
| rowspan="1"|GO:0009987[[http://amigo.geneontology.org/amigo/term/GO:0009987]]
 
−
| | biological_process
 
−
| | cellular process
 
−
| | IEA
 
−
| | TAIR:AT1G05000
 
−
|-
 
−
| rowspan="1"|GO:0008152[[http://amigo.geneontology.org/amigo/term/GO:0008152]]
 
−
| | biological_process
 
−
| | metabolic process
 
−
| | IEA
 
−
| | TAIR:AT1G05000
 
−
|-
 
−
| rowspan="1"|GO:0016787 [[http://amigo.geneontology.org/amigo/term/GO:0016787]]
 
−
| | molecular_function
 
−
| | hydrolase activity
 
−
| | IEA
 
−
| | TAIR:AT1G05000
 
−
|-
 
−
| rowspan="1"|GO:0005575[[http://amigo.geneontology.org/amigo/term/GO:0005575]]
 
−
| | cellular_component
 
−
| | cellular_component
 
−
| | IEA
 
−
| | TAIR:AT1G05000
 
−
|-
 
−
|}
 
−
 
 
−
===PFAM hits===
 
−
{| class='wikitable' style="text-align:center"
 
−
 
−
|-
 
−
! | Accession
 
−
! | Name
 
−
! | Match Start
 
−
! | Match End
 
−
! | E-value
 
−
|-
 
−
| rowspan="1"|PF03162.6 [[http://pfam.xfam.org/family/PF03162]]
 
−
| | Y_phosphatase2
 
−
| | 46
 
−
| | 198
 
−
| | 9.8e-63
 
−
|-
 
−
|}
 
−
===BlastP Searches (UniRef 100)===
 
−
{| class='wikitable' style="text-align:center"
 
−
 
−
|-
 
−
! | Accession
 
−
! | %Sim
 
−
! | Length
 
−
! | Description
 
−
! | P-value
 
−
|-
 
−
| rowspan="1"|UniRef100_Q0DX67 [[http://www.uniprot.org/uniref/UniRef100_Q0DX67]]
 
−
| | 94.12
 
−
| | 204 
 
−
| | Os02g0771400 protein n=2 Tax=Oryza sativa RepID=Q0DX67_ORYSJ
 
−
| | 4.2e-98
 
−
|-
 
−
| rowspan="1"|UniRef100_Q0DDQ5 [[http://www.uniprot.org/uniref/UniRef100_Q0DDQ5]]
 
−
| | 89.44
 
−
| | 161
 
−
| | Os06g0208700 protein n=2 Tax=Oryza sativa RepID=Q0DDQ5_ORYSJ
 
−
| | 2.2e-69
 
−
|-
 
−
| rowspan="1"|UniRef100_Q6DL00 [[http://www.uniprot.org/uniref/UniRef100_Q6DL00]]
 
−
| | 89.44
 
−
| | 161 
 
−
| | Dual-specificity phosphatase protein n=1 Tax=Oryza sativa Re
 
−
| | 2.2e-69
 
−
|-
 
−
| rowspan="1"|UniRef100_A3B9I2[[http://www.uniprot.org/uniref/UniRef100_A3B9I2]]
 
−
| | 89.44
 
−
| | 161 
 
−
| | Putative uncharacterized protein n=1 Tax=Oryza sativa Japoni
 
−
| | 3.6e-69
 
−
|-
 
−
| rowspan="1"|UniRef100_B6U4B4[[http://www.uniprot.org/uniref/UniRef100_B6U4B4]]
 
−
| | 74.77
 
−
| | 214 
 
−
| | Tyrosine specific protein phosphatase family protein n=1 Tax
 
−
| | 7.5e-69
 
−
|-
 
−
| rowspan="1"|UniRef100_F2D6J8[[http://www.uniprot.org/uniref/UniRef100_F2D6J8]]
 
−
| | 75.23
 
−
| | 214
 
−
| | Predicted protein n=1 Tax=Hordeum vulgare subsp. vulgare Rep
 
−
| | 7.5e-69
 
−
|-
 
−
| rowspan="1"|UniRef100_C4JAD1[[http://www.uniprot.org/uniref/UniRef100_C4JAD1]]
 
−
| | 75.23
 
−
| | 214
 
−
| | Putative uncharacterized protein n=1 Tax=Zea mays RepID=C4JA
 
−
| | 4.1e-68
 
−
|-
 
−
| rowspan="1"|UniRef100_B6TUQ6[[http://www.uniprot.org/uniref/UniRef100_B6TUQ6]]
 
−
| | 74.65
 
−
| | 217
 
−
| | Tyrosine specific protein phosphatase family protein n=1 Tax 
 
−
| | 2.9e-67
 
−
|-
 
−
| rowspan="1"|UniRef100_C5XTH0[[http://www.uniprot.org/uniref/UniRef100_C5XTH0]]
 
−
| | 85.29
 
−
| | 170
 
−
| | Putative uncharacterized protein Sb04g034500 n=1 Tax=Sorghum 
 
−
| | 6e-67
 
−
|-
 
−
| rowspan="1"|UniRef100_B4F971[[http://www.uniprot.org/uniref/UniRef100_B4F971]]
 
−
| | 72.22
 
−
| | 216
 
−
| | Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4F9 
 
−
| | 3.3e-66
 
−
|-
 
−
| rowspan="1"|UniRef100_UPI00015CAEE8[[http://www.uniprot.org/uniref/UniRef100_UPI00015CAEE8]]
 
−
| | 82.72
 
−
| | 162
 
−
| | PREDICTED: hypothetical protein isoform 1 n=1 Tax=Vitis vini 
 
−
| | 3.2e-61
 
−
|-
 
−
| rowspan="1"|UniRef100_B6TNL4[[http://www.uniprot.org/uniref/UniRef100_B6TNL4]]
 
−
| | 77.14
 
−
| | 175
 
−
| | Tyrosine specific protein phosphatase family protein n=1 Tax
 
−
| | 2.9e-60
 
−
|-
 
−
| rowspan="1"|UniRef100_B9T828[[http://www.uniprot.org/uniref/UniRef100_B9T828]]
 
−
| | 86.54
 
−
| | 156
 
−
| | Tyrosine-protein phosphatase SIW14, putative n=1 Tax=Ricinus
 
−
| | 2.9e-60
 
−
|-
 
−
| rowspan="1"|UniRef100_Q9ZVN4[[http://www.uniprot.org/uniref/UniRef100_Q9ZVN4]]
 
−
| | 85.99
 
−
| | 157
 
−
| | Probable tyrosine-protein phosphatase At1g05000 n=2 Tax=Arab
 
−
| | 5.9e-60
 
−
|-
 
−
| rowspan="1"|UniRef100_Q6K461[[http://www.uniprot.org/uniref/UniRef100_Q6K461]]
 
−
| | 84.18
 
−
| | 158
 
−
| | Os09g0135700 protein n=2 Tax=Oryza sativa RepID=Q6K461_ORYSJ
 
−
| | 9.7e-60
 
−
|-
 
−
| rowspan="1"|UniRef100_B9IAK7[[http://www.uniprot.org/uniref/UniRef100_B9IAK7]]
 
−
| | 85.35
 
−
| | 157
 
−
| | Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IAK7_P
 
−
| | 1.2e-59
 
−
|-
 
−
| rowspan="1"|UniRef100_UPI00015CD7AE[[http://www.uniprot.org/uniref/UniRef100_UPI00015CD7AE]]
 
−
| | 82.39
 
−
| | 159
 
−
| | PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID
 
−
| | 1.6e-59
 
−
|-
 
−
| rowspan="1"|UniRef100_B9HZH6[[http://www.uniprot.org/uniref/UniRef100_B9HZH6]]
 
−
| | 84.81
 
−
| | 158
 
−
| | Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HZH6_P
 
−
| | 3.3e-59
 
−
|-
 
−
| rowspan="1"|UniRef100_B4FLL8[[http://www.uniprot.org/uniref/UniRef100_B4FLL8]]
 
−
| | 82.5
 
−
| | 160
 
−
| | Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4FL
 
−
| | 8.7e-59
 
−
|-
 
−
| rowspan="1"|UniRef100_B9N8H3[[http://www.uniprot.org/uniref/UniRef100_B9N8H3]]
 
−
| | 84.81
 
−
| | 158
 
−
| | Predicted protein n=1 Tax=Populus trichocarpa RepID=B9N8H3_P
 
−
| | 8.7e-59
 
−
|-
 
−
|}
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
−
*Key Laboratory of Gene Engineering of Ministry of Education
+
Please input related labs here.
−
*State Key Laboratory of Biocontrol and Guangdong Key Laboratory of Plant Resources
 
−
*School of Life Sciences,Sun Yat-sen University, Guangzhou, People’s Republic of China
 
  
 
==References==
 
==References==
−
<references>
+
Please input cited references here.
−
<ref name="ref1">Jiangyi Yang, Xiaobo Zhao, Ke Cheng, Hongyi Du, Yidan Ouyang, Jiongjiong Chen, Shuqing Qiu, Jianyan Huang, Yunhe Jiang, Liwen Jiang, Jihua Ding, Jia Wang, Caiguo Xu, Xianghua Li, Qifa Zhang. (2012) A Killer-Protector System Regulates Both Hybrid Sterility and Segregation Distortion in Rice. Science 337: 1336-1340.</ref>
 
−
</references>
 
  
 
==Structured Information==
 
==Structured Information==

Revision as of 07:47, 12 May 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os02g0771400

Description

Putative tyrosine phosphatase family protein

Version

NM_001054792.2 GI:297599967 GeneID:4330871

Length

3886 bp

Definition

Oryza sativa Japonica Group Os02g0771400, complete gene.

Source

Oryza sativa Japonica Group 

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:33425073..33428958

Sequence Coding Region

33425223..33425396,33425500..33425543,33425630..33425687,33428497..33428590,33428703..33428947

Expression

GEO Profiles:Os02g0771400

Genome Context

<gbrowseImage1> name=NC_008395:33425073..33428958 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:33425073..33428958 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgcagctggagatttcgccgagacagaggagccagcagcagaaggaggaggaaggcgagcaccagcagcgcgccggcgaggaggcggtgggcgccgtcttcagcattgagccgtgggtggacgccgcggcggtgctggtgccgccgcttaacttcgccgaggtgaacgacggcatcttccgctccgggttccccgccgccgacaacttcgcgttcctcctctccctcaagctacgctcgatcgtgtacctgtgcccggagccgtacccggaggagaacacgcggtttctggagcagaacggcatcaagcttcaccagttcggtattgacggcagcaaggagctgcttgtaaacatccctgaagaaaaaatccgagaagcactcaaagttattcttgacgtaaggaatcaaccggtgctcatccactgcaagagaggcaagcaccggactggctgcgtcgttgggtgcctgagaaagttgcagaaatggtgcctaacttcagttttcgacgagtaccagcattttgcagcggcgaaggcgagaagtactgatcagagattcatggagctgtttgacacatccagcttgatgcacctgacggcctcacagtgttaa</cdnaseq>

Protein Sequence

<aaseq>MQLEISPRQRSQQQKEEEGEHQQRAGEEAVGAVFSIEPWVDAAA VLVPPLNFAEVNDGIFRSGFPAADNFAFLLSLKLRSIVYLCPEPYPEENTRFLEQNGI KLHQFGIDGSKELLVNIPEEKIREALKVILDVRNQPVLIHCKRGKHRTGCVVGCLRKL QKWCLTSVFDEYQHFAAAKARSTDQRFMELFDTSSLMHLTASQC</aaseq>

Gene Sequence

<dnaseqindica>3563..3736#3416..3459#3272..3329#369..462#12..256#aagaggaggatatgcagctggagatttcgccgagacagaggagccagcagcagaaggaggaggaaggcgagcaccagcagcgcgccggcgaggaggcggtgggcgccgtcttcagcattgagccgtgggtggacgccgcggcggtgctggtgccgccgcttaacttcgccgaggtgaacgacggcatcttccgctccgggttccccgccgccgacaacttcgcgttcctcctctccctcaagctacgctcgatcgtgtgagtcctatacctaggatctctttctcggccacggcgaccgtggcggcgagctcgtcgattacgtgttctgacggcggcggcgacgccttggcgtggttgatcggtgcaggtacctgtgcccggagccgtacccggaggagaacacgcggtttctggagcagaacggcatcaagcttcaccagttcggtattgacggcagcaaggtaaatgaacaagtcaaaaatcatatgcgttgagtcctttgattttctgctttattttccacggatggcaaagtcgatcttcgcatcgaattgttttttggtttttcggtcgatttggtgcgttctgcttgtggagataaataatttgcacacataatttgcaccgagaaatagcaactggtatcgcattacagtggatgcgagggttactttaggtagaacgcgctgtttacctgtttgacatgagcacgcacttgcgttttctgcgcgttgcctcgtgtcgtatggccatgagctcgttcgactactttccgttaaaaaaacatgggaactgacaactgatattgctgcttgcttcggcaaaacacttgggggcaacgcaactagggcaaacaacaactcaactagaacaaacaaaagtccctttcttgctttatctttgcccctttcagttagggcatttgcttgagtctttcaggctgaaaatgtttatcgtttttgggttttgttaacctaaattgacaaggttacgtggtgcatggtgactataaaacaccctgtttgagcaaaatgcatctagtgcgctactatttttatgttcttatttcactaattcgttttcccttctcacaaaatagtgtagaaaatctcattatggtaggagttattttttttacaatgcaaaacaacagtgtcagttaagcgggttcttgcgtcagcccagcacccatagaagattagaagttgtttacaatgctgcaaaagcgtatcttgctactggcctactgccattagcaacagtaaagcttatctttgttatgattattctggtagcgttgtgctacttttctagaagctagttcaaactgattggtagactcatggctaaggaaaatattttctatttcagcatcacgcatttcagggttaggagatttttgtctgcattatgccagtctggttctgagttttactgaatactgcaagctttaagggtaaaaaaaaaaaaagaaaacaccttaagcttaagtgatcagtgatgcagtacagcacaagttctactccctctatcaaaaaaaaaactaatcctaaatttgaatctagaaagacggagggagtagctgagaaatgatgggcttgtggagtctcctctgtgaattgggtgcctaaacaaagatcaagttgacttatgcccattattttttttaagagaacttatgtgaaaaaaaaagaggatcaagttgacttatagtataatcgcacctgtcttttaactgtcgagtgacgtctgaccagcgtaattctttcataaatttgttggccatgactttaattccgttattaaccagccacccaagattaccatttctctgtgtgccatgccatatttattctcattttactagtccttcactgaaagccattagtacggttttgtcaagctgtccatattaaaagttcatttaggcatagacgcatagtagccttggagtatgtcggtatattactccatctcgcaactttagtactcgtgtcatcgcgtggtagcatccaccgcaagtctgcaacaatgagaacatattccactgtcagttctgggttcatgaaggcatgaactgccacggcaaatggtcaaagttggtcagcgtcggcgacttaaggctgaggtcgttgcttgggttaggtattcatccctagttcatgcaaaatgacataactcattaacgtatgattaattaagttttagtttttttaaaaaaataaaattaatatgaatataaaatttaaattaactttcatatagatttcatatagatttttgttaaaaaaaacaccgttcagtaattaaaaaaatgtgcatgtgaaaatcgagtgagttaagttgggaccttcaaacaaaaaaaaactttcatcgttcattggcgattgttgctgtcgatgataaacaacacagatgtgctgaccaactttagcattcccagcaaaaaagaaatatatcgctgagtgaaaagacactgatcaggtggctgaccttactacaagtgtgtgaatggaaattagtgctcactttgacattgtctggagatgatgcttctttttcgccggactcaagctaggtgtctgaaaccactgaattacgagggtcaccggtaataattgtgtcactgctagatggattctaggatggtcactgctagatggattgtacggtggtgtttggatcaaggactaaactttagctcctgtcatatcggatgaatttagagtattaaacatagactacttataaaactaattacataaatgagagctaattcgcgtgacaaaatttttaagcctaattaatccataattagcgcatgtttactgtagcatcacataggctaattatgaattaattaggtttaatagattcgtctcgcgaattagtccggggtcatataataggttttattaatagtctatgtttaatatttataattagtgtccaaacatacgatgtgatatggactaaaaagttttagtcccatctaaacagggtctaagcttgtttctttgttaactagaaccaataatgtagtacatacttgagtggcatgacgatatctttgcatctgaactttcgataaaggtgaaccttatcagttaccgcattagcctgaaactgtgaaacaaattaaaacatccttctattgctataccatatcatcagtaattcagtatgcatccaactgaccattctcttcaatcctgttgactcttaaagttgatgcatagcctgacaataatctgaaccttgctgttacaggagctgcttgtaaacatccctgaagaaaaaatccgagaagcactcaaagttattcttggtatctgcctctacaaagatatatccaatgtctcaaaatttcatcacactatctgtatctaactcttatcgttttgatcaattcagacgtaaggaatcaaccggtgctcatccactgcaagagaggcaaggtagctatatctatttagcattgcacatccctgatatcccattttcttgaaaccttttgctacatgggaattcgacggtttcctgatattccacatgtttcagcaccggactggctgcgtcgttgggtgcctgagaaagttgcagaaatggtgcctaacttcagttttcgacgagtaccagcattttgcagcggcgaaggcgagaagtactgatcagagattcatggagctgtttgacacatccagcttgatgcacctgacggcctcacagtgttaaccgaaccgaatgttttttcatatccggtcccgatctgtaaccatgctgtctacctagcaacatattgtaatgttgctattgaaacaattcatcagagaataatgttagaaccatcattatcctcataaaagtatccatcaaaatacaagg</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0771400, RefSeq:Os02g0771400

Retrieved from "https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g0771400&oldid=168387"