Difference between revisions of "Os02g0771400"
m (Reverted edits by Xialin (talk) to last revision by 124.16.129.48) |
|||
| Line 1: | Line 1: | ||
| − | + | Protein Tyrosine Phosphatase | |
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | + | OsPFA-DSP2 act as negative regulators of the pathogen response in transgenic plants.Ectopic overexpression of OsPFA-DSP2 in rice increased sensitivity to Magnaporthe grisea (M. grisea Z1 strain), inhibited the accumulation of hydrogen peroxide (H2O2) and suppressed the expression of pathogenesis-related (PR) genes after fungal infection. | |
===Expression=== | ===Expression=== | ||
| − | + | OsPFA-DSP2 was mainly expressed in calli, seedlings, roots, and young panicles, and localized in cytoplasm and nucleus. | |
===Evolution=== | ===Evolution=== | ||
| − | |||
| − | + | AtPFA-DSP4,which is homologous to OsPFA-DSP2,overexpressing in transgenic Arabidopsis plants,also exhibited sensitivity to | |
| + | Pseudomonas syringae pv. tomato DC3000 (Pst DC3000), reduced accumulation of H2O2 and decreased photosynthesic capacity after infection compared with Col-0.OsPFA-DSP2 and AtPFA-DSP4 act as negative regulators of the pathogen response in transgenic plants. | ||
| + | |||
| + | ===Gene Ontology Classification === | ||
| + | {| class='wikitable' style="text-align:center" | ||
| + | |- | ||
| + | ! | GO accession | ||
| + | ! | Type | ||
| + | ! | Name | ||
| + | ! | Code | ||
| + | ! | With | ||
| + | |- | ||
| + | | rowspan="1"|GO:0009987[[http://amigo.geneontology.org/amigo/term/GO:0009987]] | ||
| + | | | biological_process | ||
| + | | | cellular process | ||
| + | | | IEA | ||
| + | | | TAIR:AT1G05000 | ||
| + | |- | ||
| + | | rowspan="1"|GO:0008152[[http://amigo.geneontology.org/amigo/term/GO:0008152]] | ||
| + | | | biological_process | ||
| + | | | metabolic process | ||
| + | | | IEA | ||
| + | | | TAIR:AT1G05000 | ||
| + | |- | ||
| + | | rowspan="1"|GO:0016787 [[http://amigo.geneontology.org/amigo/term/GO:0016787]] | ||
| + | | | molecular_function | ||
| + | | | hydrolase activity | ||
| + | | | IEA | ||
| + | | | TAIR:AT1G05000 | ||
| + | |- | ||
| + | | rowspan="1"|GO:0005575[[http://amigo.geneontology.org/amigo/term/GO:0005575]] | ||
| + | | | cellular_component | ||
| + | | | cellular_component | ||
| + | | | IEA | ||
| + | | | TAIR:AT1G05000 | ||
| + | |- | ||
| + | |} | ||
| + | |||
| + | ===PFAM hits=== | ||
| + | {| class='wikitable' style="text-align:center" | ||
| + | |||
| + | |- | ||
| + | ! | Accession | ||
| + | ! | Name | ||
| + | ! | Match Start | ||
| + | ! | Match End | ||
| + | ! | E-value | ||
| + | |- | ||
| + | | rowspan="1"|PF03162.6 [[http://pfam.xfam.org/family/PF03162]] | ||
| + | | | Y_phosphatase2 | ||
| + | | | 46 | ||
| + | | | 198 | ||
| + | | | 9.8e-63 | ||
| + | |- | ||
| + | |} | ||
| + | ===BlastP Searches (UniRef 100)=== | ||
| + | {| class='wikitable' style="text-align:center" | ||
| + | |||
| + | |- | ||
| + | ! | Accession | ||
| + | ! | %Sim | ||
| + | ! | Length | ||
| + | ! | Description | ||
| + | ! | P-value | ||
| + | |- | ||
| + | | rowspan="1"|UniRef100_Q0DX67 [[http://www.uniprot.org/uniref/UniRef100_Q0DX67]] | ||
| + | | | 94.12 | ||
| + | | | 204 | ||
| + | | | Os02g0771400 protein n=2 Tax=Oryza sativa RepID=Q0DX67_ORYSJ | ||
| + | | | 4.2e-98 | ||
| + | |- | ||
| + | | rowspan="1"|UniRef100_Q0DDQ5 [[http://www.uniprot.org/uniref/UniRef100_Q0DDQ5]] | ||
| + | | | 89.44 | ||
| + | | | 161 | ||
| + | | | Os06g0208700 protein n=2 Tax=Oryza sativa RepID=Q0DDQ5_ORYSJ | ||
| + | | | 2.2e-69 | ||
| + | |- | ||
| + | | rowspan="1"|UniRef100_Q6DL00 [[http://www.uniprot.org/uniref/UniRef100_Q6DL00]] | ||
| + | | | 89.44 | ||
| + | | | 161 | ||
| + | | | Dual-specificity phosphatase protein n=1 Tax=Oryza sativa Re | ||
| + | | | 2.2e-69 | ||
| + | |- | ||
| + | | rowspan="1"|UniRef100_A3B9I2[[http://www.uniprot.org/uniref/UniRef100_A3B9I2]] | ||
| + | | | 89.44 | ||
| + | | | 161 | ||
| + | | | Putative uncharacterized protein n=1 Tax=Oryza sativa Japoni | ||
| + | | | 3.6e-69 | ||
| + | |- | ||
| + | | rowspan="1"|UniRef100_B6U4B4[[http://www.uniprot.org/uniref/UniRef100_B6U4B4]] | ||
| + | | | 74.77 | ||
| + | | | 214 | ||
| + | | | Tyrosine specific protein phosphatase family protein n=1 Tax | ||
| + | | | 7.5e-69 | ||
| + | |- | ||
| + | | rowspan="1"|UniRef100_F2D6J8[[http://www.uniprot.org/uniref/UniRef100_F2D6J8]] | ||
| + | | | 75.23 | ||
| + | | | 214 | ||
| + | | | Predicted protein n=1 Tax=Hordeum vulgare subsp. vulgare Rep | ||
| + | | | 7.5e-69 | ||
| + | |- | ||
| + | | rowspan="1"|UniRef100_C4JAD1[[http://www.uniprot.org/uniref/UniRef100_C4JAD1]] | ||
| + | | | 75.23 | ||
| + | | | 214 | ||
| + | | | Putative uncharacterized protein n=1 Tax=Zea mays RepID=C4JA | ||
| + | | | 4.1e-68 | ||
| + | |- | ||
| + | | rowspan="1"|UniRef100_B6TUQ6[[http://www.uniprot.org/uniref/UniRef100_B6TUQ6]] | ||
| + | | | 74.65 | ||
| + | | | 217 | ||
| + | | | Tyrosine specific protein phosphatase family protein n=1 Tax | ||
| + | | | 2.9e-67 | ||
| + | |- | ||
| + | | rowspan="1"|UniRef100_C5XTH0[[http://www.uniprot.org/uniref/UniRef100_C5XTH0]] | ||
| + | | | 85.29 | ||
| + | | | 170 | ||
| + | | | Putative uncharacterized protein Sb04g034500 n=1 Tax=Sorghum | ||
| + | | | 6e-67 | ||
| + | |- | ||
| + | | rowspan="1"|UniRef100_B4F971[[http://www.uniprot.org/uniref/UniRef100_B4F971]] | ||
| + | | | 72.22 | ||
| + | | | 216 | ||
| + | | | Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4F9 | ||
| + | | | 3.3e-66 | ||
| + | |- | ||
| + | | rowspan="1"|UniRef100_UPI00015CAEE8[[http://www.uniprot.org/uniref/UniRef100_UPI00015CAEE8]] | ||
| + | | | 82.72 | ||
| + | | | 162 | ||
| + | | | PREDICTED: hypothetical protein isoform 1 n=1 Tax=Vitis vini | ||
| + | | | 3.2e-61 | ||
| + | |- | ||
| + | | rowspan="1"|UniRef100_B6TNL4[[http://www.uniprot.org/uniref/UniRef100_B6TNL4]] | ||
| + | | | 77.14 | ||
| + | | | 175 | ||
| + | | | Tyrosine specific protein phosphatase family protein n=1 Tax | ||
| + | | | 2.9e-60 | ||
| + | |- | ||
| + | | rowspan="1"|UniRef100_B9T828[[http://www.uniprot.org/uniref/UniRef100_B9T828]] | ||
| + | | | 86.54 | ||
| + | | | 156 | ||
| + | | | Tyrosine-protein phosphatase SIW14, putative n=1 Tax=Ricinus | ||
| + | | | 2.9e-60 | ||
| + | |- | ||
| + | | rowspan="1"|UniRef100_Q9ZVN4[[http://www.uniprot.org/uniref/UniRef100_Q9ZVN4]] | ||
| + | | | 85.99 | ||
| + | | | 157 | ||
| + | | | Probable tyrosine-protein phosphatase At1g05000 n=2 Tax=Arab | ||
| + | | | 5.9e-60 | ||
| + | |- | ||
| + | | rowspan="1"|UniRef100_Q6K461[[http://www.uniprot.org/uniref/UniRef100_Q6K461]] | ||
| + | | | 84.18 | ||
| + | | | 158 | ||
| + | | | Os09g0135700 protein n=2 Tax=Oryza sativa RepID=Q6K461_ORYSJ | ||
| + | | | 9.7e-60 | ||
| + | |- | ||
| + | | rowspan="1"|UniRef100_B9IAK7[[http://www.uniprot.org/uniref/UniRef100_B9IAK7]] | ||
| + | | | 85.35 | ||
| + | | | 157 | ||
| + | | | Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IAK7_P | ||
| + | | | 1.2e-59 | ||
| + | |- | ||
| + | | rowspan="1"|UniRef100_UPI00015CD7AE[[http://www.uniprot.org/uniref/UniRef100_UPI00015CD7AE]] | ||
| + | | | 82.39 | ||
| + | | | 159 | ||
| + | | | PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID | ||
| + | | | 1.6e-59 | ||
| + | |- | ||
| + | | rowspan="1"|UniRef100_B9HZH6[[http://www.uniprot.org/uniref/UniRef100_B9HZH6]] | ||
| + | | | 84.81 | ||
| + | | | 158 | ||
| + | | | Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HZH6_P | ||
| + | | | 3.3e-59 | ||
| + | |- | ||
| + | | rowspan="1"|UniRef100_B4FLL8[[http://www.uniprot.org/uniref/UniRef100_B4FLL8]] | ||
| + | | | 82.5 | ||
| + | | | 160 | ||
| + | | | Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4FL | ||
| + | | | 8.7e-59 | ||
| + | |- | ||
| + | | rowspan="1"|UniRef100_B9N8H3[[http://www.uniprot.org/uniref/UniRef100_B9N8H3]] | ||
| + | | | 84.81 | ||
| + | | | 158 | ||
| + | | | Predicted protein n=1 Tax=Populus trichocarpa RepID=B9N8H3_P | ||
| + | | | 8.7e-59 | ||
| + | |- | ||
| + | |} | ||
==Labs working on this gene== | ==Labs working on this gene== | ||
| − | + | *Key Laboratory of Gene Engineering of Ministry of Education | |
| + | *State Key Laboratory of Biocontrol and Guangdong Key Laboratory of Plant Resources | ||
| + | *School of Life Sciences,Sun Yat-sen University, Guangzhou, People’s Republic of China | ||
==References== | ==References== | ||
| − | + | <references> | |
| + | <ref name="ref1">Jiangyi Yang, Xiaobo Zhao, Ke Cheng, Hongyi Du, Yidan Ouyang, Jiongjiong Chen, Shuqing Qiu, Jianyan Huang, Yunhe Jiang, Liwen Jiang, Jihua Ding, Jia Wang, Caiguo Xu, Xianghua Li, Qifa Zhang. (2012) A Killer-Protector System Regulates Both Hybrid Sterility and Segregation Distortion in Rice. Science 337: 1336-1340.</ref> | ||
| + | </references> | ||
==Structured Information== | ==Structured Information== | ||
Revision as of 07:48, 12 May 2014
Protein Tyrosine Phosphatase
Contents
Annotated Information
Function
OsPFA-DSP2 act as negative regulators of the pathogen response in transgenic plants.Ectopic overexpression of OsPFA-DSP2 in rice increased sensitivity to Magnaporthe grisea (M. grisea Z1 strain), inhibited the accumulation of hydrogen peroxide (H2O2) and suppressed the expression of pathogenesis-related (PR) genes after fungal infection.
Expression
OsPFA-DSP2 was mainly expressed in calli, seedlings, roots, and young panicles, and localized in cytoplasm and nucleus.
Evolution
AtPFA-DSP4,which is homologous to OsPFA-DSP2,overexpressing in transgenic Arabidopsis plants,also exhibited sensitivity to Pseudomonas syringae pv. tomato DC3000 (Pst DC3000), reduced accumulation of H2O2 and decreased photosynthesic capacity after infection compared with Col-0.OsPFA-DSP2 and AtPFA-DSP4 act as negative regulators of the pathogen response in transgenic plants.
Gene Ontology Classification
| GO accession | Type | Name | Code | With |
|---|---|---|---|---|
| GO:0009987[[1]] | biological_process | cellular process | IEA | TAIR:AT1G05000 |
| GO:0008152[[2]] | biological_process | metabolic process | IEA | TAIR:AT1G05000 |
| GO:0016787 [[3]] | molecular_function | hydrolase activity | IEA | TAIR:AT1G05000 |
| GO:0005575[[4]] | cellular_component | cellular_component | IEA | TAIR:AT1G05000 |
PFAM hits
| Accession | Name | Match Start | Match End | E-value |
|---|---|---|---|---|
| PF03162.6 [[5]] | Y_phosphatase2 | 46 | 198 | 9.8e-63 |
BlastP Searches (UniRef 100)
| Accession | %Sim | Length | Description | P-value |
|---|---|---|---|---|
| UniRef100_Q0DX67 [[6]] | 94.12 | 204 | Os02g0771400 protein n=2 Tax=Oryza sativa RepID=Q0DX67_ORYSJ | 4.2e-98 |
| UniRef100_Q0DDQ5 [[7]] | 89.44 | 161 | Os06g0208700 protein n=2 Tax=Oryza sativa RepID=Q0DDQ5_ORYSJ | 2.2e-69 |
| UniRef100_Q6DL00 [[8]] | 89.44 | 161 | Dual-specificity phosphatase protein n=1 Tax=Oryza sativa Re | 2.2e-69 |
| UniRef100_A3B9I2[[9]] | 89.44 | 161 | Putative uncharacterized protein n=1 Tax=Oryza sativa Japoni | 3.6e-69 |
| UniRef100_B6U4B4[[10]] | 74.77 | 214 | Tyrosine specific protein phosphatase family protein n=1 Tax | 7.5e-69 |
| UniRef100_F2D6J8[[11]] | 75.23 | 214 | Predicted protein n=1 Tax=Hordeum vulgare subsp. vulgare Rep | 7.5e-69 |
| UniRef100_C4JAD1[[12]] | 75.23 | 214 | Putative uncharacterized protein n=1 Tax=Zea mays RepID=C4JA | 4.1e-68 |
| UniRef100_B6TUQ6[[13]] | 74.65 | 217 | Tyrosine specific protein phosphatase family protein n=1 Tax | 2.9e-67 |
| UniRef100_C5XTH0[[14]] | 85.29 | 170 | Putative uncharacterized protein Sb04g034500 n=1 Tax=Sorghum | 6e-67 |
| UniRef100_B4F971[[15]] | 72.22 | 216 | Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4F9 | 3.3e-66 |
| UniRef100_UPI00015CAEE8[[16]] | 82.72 | 162 | PREDICTED: hypothetical protein isoform 1 n=1 Tax=Vitis vini | 3.2e-61 |
| UniRef100_B6TNL4[[17]] | 77.14 | 175 | Tyrosine specific protein phosphatase family protein n=1 Tax | 2.9e-60 |
| UniRef100_B9T828[[18]] | 86.54 | 156 | Tyrosine-protein phosphatase SIW14, putative n=1 Tax=Ricinus | 2.9e-60 |
| UniRef100_Q9ZVN4[[19]] | 85.99 | 157 | Probable tyrosine-protein phosphatase At1g05000 n=2 Tax=Arab | 5.9e-60 |
| UniRef100_Q6K461[[20]] | 84.18 | 158 | Os09g0135700 protein n=2 Tax=Oryza sativa RepID=Q6K461_ORYSJ | 9.7e-60 |
| UniRef100_B9IAK7[[21]] | 85.35 | 157 | Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IAK7_P | 1.2e-59 |
| UniRef100_UPI00015CD7AE[[22]] | 82.39 | 159 | PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID | 1.6e-59 |
| UniRef100_B9HZH6[[23]] | 84.81 | 158 | Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HZH6_P | 3.3e-59 |
| UniRef100_B4FLL8[[24]] | 82.5 | 160 | Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4FL | 8.7e-59 |
| UniRef100_B9N8H3[[25]] | 84.81 | 158 | Predicted protein n=1 Tax=Populus trichocarpa RepID=B9N8H3_P | 8.7e-59 |
Labs working on this gene
- Key Laboratory of Gene Engineering of Ministry of Education
- State Key Laboratory of Biocontrol and Guangdong Key Laboratory of Plant Resources
- School of Life Sciences,Sun Yat-sen University, Guangzhou, People’s Republic of China
References
Cite error: <ref> tag defined in <references> has group attribute "" which does not appear in prior text.
Structured Information
| Gene Name |
Os02g0771400 |
|---|---|
| Description |
Putative tyrosine phosphatase family protein |
| Version |
NM_001054792.2 GI:297599967 GeneID:4330871 |
| Length |
3886 bp |
| Definition |
Oryza sativa Japonica Group Os02g0771400, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 2:33425073..33428958 |
| Sequence Coding Region |
33425223..33425396,33425500..33425543,33425630..33425687,33428497..33428590,33428703..33428947 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008395:33425073..33428958 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008395:33425073..33428958 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgcagctggagatttcgccgagacagaggagccagcagcagaaggaggaggaaggcgagcaccagcagcgcgccggcgaggaggcggtgggcgccgtcttcagcattgagccgtgggtggacgccgcggcggtgctggtgccgccgcttaacttcgccgaggtgaacgacggcatcttccgctccgggttccccgccgccgacaacttcgcgttcctcctctccctcaagctacgctcgatcgtgtacctgtgcccggagccgtacccggaggagaacacgcggtttctggagcagaacggcatcaagcttcaccagttcggtattgacggcagcaaggagctgcttgtaaacatccctgaagaaaaaatccgagaagcactcaaagttattcttgacgtaaggaatcaaccggtgctcatccactgcaagagaggcaagcaccggactggctgcgtcgttgggtgcctgagaaagttgcagaaatggtgcctaacttcagttttcgacgagtaccagcattttgcagcggcgaaggcgagaagtactgatcagagattcatggagctgtttgacacatccagcttgatgcacctgacggcctcacagtgttaa</cdnaseq> |
| Protein Sequence |
<aaseq>MQLEISPRQRSQQQKEEEGEHQQRAGEEAVGAVFSIEPWVDAAA VLVPPLNFAEVNDGIFRSGFPAADNFAFLLSLKLRSIVYLCPEPYPEENTRFLEQNGI KLHQFGIDGSKELLVNIPEEKIREALKVILDVRNQPVLIHCKRGKHRTGCVVGCLRKL QKWCLTSVFDEYQHFAAAKARSTDQRFMELFDTSSLMHLTASQC</aaseq> |
| Gene Sequence |
<dnaseqindica>3563..3736#3416..3459#3272..3329#369..462#12..256#aagaggaggatatgcagctggagatttcgccgagacagaggagccagcagcagaaggaggaggaaggcgagcaccagcagcgcgccggcgaggaggcggtgggcgccgtcttcagcattgagccgtgggtggacgccgcggcggtgctggtgccgccgcttaacttcgccgaggtgaacgacggcatcttccgctccgggttccccgccgccgacaacttcgcgttcctcctctccctcaagctacgctcgatcgtgtgagtcctatacctaggatctctttctcggccacggcgaccgtggcggcgagctcgtcgattacgtgttctgacggcggcggcgacgccttggcgtggttgatcggtgcaggtacctgtgcccggagccgtacccggaggagaacacgcggtttctggagcagaacggcatcaagcttcaccagttcggtattgacggcagcaaggtaaatgaacaagtcaaaaatcatatgcgttgagtcctttgattttctgctttattttccacggatggcaaagtcgatcttcgcatcgaattgttttttggtttttcggtcgatttggtgcgttctgcttgtggagataaataatttgcacacataatttgcaccgagaaatagcaactggtatcgcattacagtggatgcgagggttactttaggtagaacgcgctgtttacctgtttgacatgagcacgcacttgcgttttctgcgcgttgcctcgtgtcgtatggccatgagctcgttcgactactttccgttaaaaaaacatgggaactgacaactgatattgctgcttgcttcggcaaaacacttgggggcaacgcaactagggcaaacaacaactcaactagaacaaacaaaagtccctttcttgctttatctttgcccctttcagttagggcatttgcttgagtctttcaggctgaaaatgtttatcgtttttgggttttgttaacctaaattgacaaggttacgtggtgcatggtgactataaaacaccctgtttgagcaaaatgcatctagtgcgctactatttttatgttcttatttcactaattcgttttcccttctcacaaaatagtgtagaaaatctcattatggtaggagttattttttttacaatgcaaaacaacagtgtcagttaagcgggttcttgcgtcagcccagcacccatagaagattagaagttgtttacaatgctgcaaaagcgtatcttgctactggcctactgccattagcaacagtaaagcttatctttgttatgattattctggtagcgttgtgctacttttctagaagctagttcaaactgattggtagactcatggctaaggaaaatattttctatttcagcatcacgcatttcagggttaggagatttttgtctgcattatgccagtctggttctgagttttactgaatactgcaagctttaagggtaaaaaaaaaaaaagaaaacaccttaagcttaagtgatcagtgatgcagtacagcacaagttctactccctctatcaaaaaaaaaactaatcctaaatttgaatctagaaagacggagggagtagctgagaaatgatgggcttgtggagtctcctctgtgaattgggtgcctaaacaaagatcaagttgacttatgcccattattttttttaagagaacttatgtgaaaaaaaaagaggatcaagttgacttatagtataatcgcacctgtcttttaactgtcgagtgacgtctgaccagcgtaattctttcataaatttgttggccatgactttaattccgttattaaccagccacccaagattaccatttctctgtgtgccatgccatatttattctcattttactagtccttcactgaaagccattagtacggttttgtcaagctgtccatattaaaagttcatttaggcatagacgcatagtagccttggagtatgtcggtatattactccatctcgcaactttagtactcgtgtcatcgcgtggtagcatccaccgcaagtctgcaacaatgagaacatattccactgtcagttctgggttcatgaaggcatgaactgccacggcaaatggtcaaagttggtcagcgtcggcgacttaaggctgaggtcgttgcttgggttaggtattcatccctagttcatgcaaaatgacataactcattaacgtatgattaattaagttttagtttttttaaaaaaataaaattaatatgaatataaaatttaaattaactttcatatagatttcatatagatttttgttaaaaaaaacaccgttcagtaattaaaaaaatgtgcatgtgaaaatcgagtgagttaagttgggaccttcaaacaaaaaaaaactttcatcgttcattggcgattgttgctgtcgatgataaacaacacagatgtgctgaccaactttagcattcccagcaaaaaagaaatatatcgctgagtgaaaagacactgatcaggtggctgaccttactacaagtgtgtgaatggaaattagtgctcactttgacattgtctggagatgatgcttctttttcgccggactcaagctaggtgtctgaaaccactgaattacgagggtcaccggtaataattgtgtcactgctagatggattctaggatggtcactgctagatggattgtacggtggtgtttggatcaaggactaaactttagctcctgtcatatcggatgaatttagagtattaaacatagactacttataaaactaattacataaatgagagctaattcgcgtgacaaaatttttaagcctaattaatccataattagcgcatgtttactgtagcatcacataggctaattatgaattaattaggtttaatagattcgtctcgcgaattagtccggggtcatataataggttttattaatagtctatgtttaatatttataattagtgtccaaacatacgatgtgatatggactaaaaagttttagtcccatctaaacagggtctaagcttgtttctttgttaactagaaccaataatgtagtacatacttgagtggcatgacgatatctttgcatctgaactttcgataaaggtgaaccttatcagttaccgcattagcctgaaactgtgaaacaaattaaaacatccttctattgctataccatatcatcagtaattcagtatgcatccaactgaccattctcttcaatcctgttgactcttaaagttgatgcatagcctgacaataatctgaaccttgctgttacaggagctgcttgtaaacatccctgaagaaaaaatccgagaagcactcaaagttattcttggtatctgcctctacaaagatatatccaatgtctcaaaatttcatcacactatctgtatctaactcttatcgttttgatcaattcagacgtaaggaatcaaccggtgctcatccactgcaagagaggcaaggtagctatatctatttagcattgcacatccctgatatcccattttcttgaaaccttttgctacatgggaattcgacggtttcctgatattccacatgtttcagcaccggactggctgcgtcgttgggtgcctgagaaagttgcagaaatggtgcctaacttcagttttcgacgagtaccagcattttgcagcggcgaaggcgagaagtactgatcagagattcatggagctgtttgacacatccagcttgatgcacctgacggcctcacagtgttaaccgaaccgaatgttttttcatatccggtcccgatctgtaaccatgctgtctacctagcaacatattgtaatgttgctattgaaacaattcatcagagaataatgttagaaccatcattatcctcataaaagtatccatcaaaatacaagg</dnaseqindica> |
| External Link(s) |