Difference between revisions of "Os01g0831000"
Lixiaoman13 (talk | contribs) (→Function) |
Lixiaoman13 (talk | contribs) (→Function) |
||
| Line 3: | Line 3: | ||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | LAX PANICLE (LAX) is involved in the formation of all types of axillary meristems throughout the ontogeny of a rice plant, and/or maintenance during rice reproductive development, and functions redundantly with SPA (SMALL PANICLE) in the same genetic pathway. LAX may transiently accumulate in the initiating [http://en.wikipedia.org/wiki/ | + | LAX PANICLE (LAX) is involved in the formation of all types of axillary meristems throughout the ontogeny of a rice plant, and/or maintenance during rice reproductive development, and functions redundantly with SPA (SMALL PANICLE) in the same genetic pathway. LAX may transiently accumulate in the initiating apical [http://en.wikipedia.org/wiki/Meristem] at the plastochron 4 stage, which strictly regulates mRNA expression and subsequent control of protein [http://en.wikipedia.org/wiki/Protein trafficking]<ref name="ref1" />. Ectopic LAX expression in rice caused pleiotropic effects, including dwarfing, an altered pattern of stem elongation, darker color, bending of the lamina joint, absence of the midribs of leaves, and severe sterility<ref name="ref2" />. |
===Mutation=== | ===Mutation=== | ||
Revision as of 04:33, 13 May 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
LAX PANICLE (LAX) is involved in the formation of all types of axillary meristems throughout the ontogeny of a rice plant, and/or maintenance during rice reproductive development, and functions redundantly with SPA (SMALL PANICLE) in the same genetic pathway. LAX may transiently accumulate in the initiating apical [1] at the plastochron 4 stage, which strictly regulates mRNA expression and subsequent control of protein trafficking[1]. Ectopic LAX expression in rice caused pleiotropic effects, including dwarfing, an altered pattern of stem elongation, darker color, bending of the lamina joint, absence of the midribs of leaves, and severe sterility[2].
Mutation
In strong mutant alleles of the LAX locus, such as lax-2 and lax-3, the initiation of lateral spikelets is completely suppressed, and panicle branches are also severely reduced. On the other hand, the defects were observed only in the lateral spikelets in lax-1, lax-4, and lax-5, which are weak mutant alleles of LAX(figure 1).
An insertion of a retro transposon was detected in the lax-1 allele[2].
The existence of a long deletion, which contains five predicted genes, PG1 to PG5, was identified in the lax-2 allele[2].
A 59-bp region was deleted in lax-3.
Amino acid substitutions were found in lax-4 and lax-5, R50D or A49T, respectively.
Expression
LAX cDNA is 1,080-bp in length cloned by screening a cDNA library prepared from very young inflorescences. Sequencing of the LAX cDNA revealed that the LAX gene is intronless and encodes an ORF of 215 aa. It encodes a basic helix–loop–helix transcription factor and is expressed in the boundary between the shoot apical meristem and the region of new meristem formation(figure 2). This pattern of LAX expression was repeatedly observed in every axillary meristem[2].
_and_OSH1_(E,_I,_and_K)..jpg)
Evolution
The LAX bHLH domain showed high sequence similarity to that of other plant bHLH proteins and bHLH proteins predicted from the rice genome sequence(figure 3). Outside of the bHLH region, however, no other conserved domains were identified. A database search failed to identify cognate homologs of LAX in the Arabidopsis genome, suggesting a possibility that LAX represents a grass-specific regulator of shoot branching[2].
Knowledge Extension
By map-based cloning, LAX2 was isolated from the lax2 (LAX PANICLE 2)mutant, which has a similar phenotype to lax1 in that it lacks an AM in most of the lateral branches of the panicle, and has a reduced number of AMs at the vegetative stage. LAX2 encodes a nuclear protein that physically interacts with LAX1, suggesting that the two LAXs may act together in regulating rice AM formation process[3].
Labs working on this gene
1.Graduate School of Agriculture and Life Science, University of Tokyo, Yayoi 1-1-1, Bunkyo, Tokyo 113-8657, Japan
2.Research Institute for Bioresources,Okayama University, Chuou 2-20-1, Kurashiki, Okayama 710-0046, Japan
3.CREST, Japan Science and Technology Corporation, Honcho 4-1-8,Kawaguchi, Saitama 332-0012, Japan
4.Department of Bio-Science, Nara Institute of Science and Technology, Takayama 8916-5,Ikoma, Nara 630-0101, Japan
5.Crop Development Division, National Agriculture and Food Research Organization Agricultural Research Center, Niigata 943-0193, Japan
6.National Center for Plant Gene Research, Key Laboratory of Molecular and Developmental Biology, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, People’s Republic of China
7.Department of Biological Mechanisms and Functions, Graduate School of Bioagricultural Sciences, Nagoya University, Nagoya 464-8601, Japan
8.Photosynthesis and Photobiology Research Unit, National Institute of Agrobiological Sciences, Tsukuba 305-8602, Japan
9.State Key Laboratory of Rice Biology, China National Rice Research Institute, Chinese Academy of Agricultural Sciences, Hangzhou 310006, People’s Republic of China
10.Institute of Radiation Breeding, National Institute of Agrobiological Sciences, Hitachi-ohmiya 319-2293, Japan
11.Bioscience and Biotechnology Center, Nagoya University, Nagoya 464-8601, Japan
12.Rice Research Division, National Institute of Crop Science, National Agriculture and Food Research Organization, Tsukuba 305-8518, Japan
13.Department of Agricultural and Environmental biology, Graduate School of Agricultural and Life Sciences, University of Tokyo, Tokyo 113-8657, Japan
14.Precursory Research for Embryonic Science and Technology, Japan Science and Technology Agency, Kawaguchi 332-0012, Japan
References
- ↑ Oikawa, T. and J. Kyozuka (2009). "Two-Step Regulation of LAX PANICLE1 Protein Accumulation in Axillary Meristem Formation in Rice." Plant Cell 21(4): 1095-1108.
- ↑ 2.0 2.1 2.2 2.3 2.4 2.5 2.6 2.7 Komatsu, K., et al. (2003). "LAX and SPA: major regulators of shoot branching in rice." Proc Natl Acad Sci U S A 100(20): 11765-11770.
- ↑ Tabuchi, H., et al. (2011). "LAX PANICLE2 of rice encodes a novel nuclear protein and regulates the formation of axillary meristems." Plant Cell 23(9): 3276-3287.
Structured Information
| Gene Name |
Os01g0831000 |
|---|---|
| Description |
Transcription factor LAX PANICLE, a basic helix-loop-helix (bHLH) transcription factor |
| Version |
NM_001051234.1 GI:115440838 GeneID:4327431 |
| Length |
1078 bp |
| Definition |
Oryza sativa Japonica Group Os01g0831000, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:37313995..37315072 |
| Sequence Coding Region |
37314110..37314757 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:37313995..37315072 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:37313995..37315072 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgcatgacccacgcggcttccccatccacccgcagccgtaccacctccaccccacggccggcggcctcggcgagggcaggatgcggggcggcgggcggcggcgccccggcgccaagctctccaccgacccgcagagcgtggcggcgcgggagcggcggcaccggatcagcgaccgcttccgcgtgctccgcagcctcgtgccgggcggcagcaagatggacacggtgtccatgctggagcaggccatccactacgtcaagttcctcaaggcgcaggtcaccctgcaccaggccgcgctcgtgcagcacgaggagggctgccagcacgccgacgtcgccgcggcgttctccgccgccgacgccgatctggcccttgagctgaaccatcgccacggcggcgccggcgatgatgacgccgggatgacgacgctggagatggcgccgatgcaagaggcggtgggctacggcgacggcccggctcatcagatgatgcagcaagcgctcgatccagcggggcagctgatgatgggcggcgctcatcagctgcctcctttgccttgctgtgtcttcgtccaggagactgacccctcgtgctactcggtgtgcaatgtccacggtgaggagtctggtgcgcaaggatcttattag</cdnaseq> |
| Protein Sequence |
<aaseq>MHDPRGFPIHPQPYHLHPTAGGLGEGRMRGGGRRRPGAKLSTDP QSVAARERRHRISDRFRVLRSLVPGGSKMDTVSMLEQAIHYVKFLKAQVTLHQAALVQ HEEGCQHADVAAAFSAADADLALELNHRHGGAGDDDAGMTTLEMAPMQEAVGYGDGPA HQMMQQALDPAGQLMMGGAHQLPPLPCCVFVQETDPSCYSVCNVHGEESGAQGSY</aaseq> |
| Gene Sequence |
<dnaseqindica>116..763#caggggctgaaacaaacccagcacatttgtgtttgtacgcgcagctagctagccacgagcgcggatccatctcctagctagcgcaccatctatggatccataccacgactaaaacatgcatgacccacgcggcttccccatccacccgcagccgtaccacctccaccccacggccggcggcctcggcgagggcaggatgcggggcggcgggcggcggcgccccggcgccaagctctccaccgacccgcagagcgtggcggcgcgggagcggcggcaccggatcagcgaccgcttccgcgtgctccgcagcctcgtgccgggcggcagcaagatggacacggtgtccatgctggagcaggccatccactacgtcaagttcctcaaggcgcaggtcaccctgcaccaggccgcgctcgtgcagcacgaggagggctgccagcacgccgacgtcgccgcggcgttctccgccgccgacgccgatctggcccttgagctgaaccatcgccacggcggcgccggcgatgatgacgccgggatgacgacgctggagatggcgccgatgcaagaggcggtgggctacggcgacggcccggctcatcagatgatgcagcaagcgctcgatccagcggggcagctgatgatgggcggcgctcatcagctgcctcctttgccttgctgtgtcttcgtccaggagactgacccctcgtgctactcggtgtgcaatgtccacggtgaggagtctggtgcgcaaggatcttattagctagctagtgagacagtggcttgcttaggtagttaatttccttaagtatgctcgaatattggctctacccactagctgtctagctctacttagcttacctaggtcgtcaaccaatatattaccggttggtcatggtcccttaaattagctagactcttgatttctgtaagaatgcatatatgcatgcatggggttctgttggagcaatgcataacagagctttgttttacatgcatgcgtgcatgcttcctagatatcattctgaaatctgaacttgtttgctcgatcgcttaattgctatctcaccatttcggt</dnaseqindica> |
| External Link(s) |
