Difference between revisions of "Os01g0131600"

From RiceWiki
Jump to: navigation, search
(References)
(References)
Line 70: Line 70:
 
<ref name="pmid:20357136">Hinz, M; Wilson, IW; Yang, J; Buerstenbinder, K; Llewellyn, D; Dennis, ES; Sauter, M; Dolferus, R. (2010) Arabidopsis RAP2.2: an ethylene response transcription factor that is important for hypoxia survival.Plant physiology 153: 2.</ref>
 
<ref name="pmid:20357136">Hinz, M; Wilson, IW; Yang, J; Buerstenbinder, K; Llewellyn, D; Dennis, ES; Sauter, M; Dolferus, R. (2010) Arabidopsis RAP2.2: an ethylene response transcription factor that is important for hypoxia survival.Plant physiology 153: 2.</ref>
 
<ref name="pmid:14577371">Liu, HQ; Wu, WR; Duan, YL; Guan, HZ; Chen, J; Li, WM; Xue, YB. (2003) [Towards the positional cloning of a spikelet identity gene frizzle panicle (FZP) in rice (Oryza sativa L.)].Yi chuan xue bao = Acta genetica Sinica 30: 9.</ref>
 
<ref name="pmid:14577371">Liu, HQ; Wu, WR; Duan, YL; Guan, HZ; Chen, J; Li, WM; Xue, YB. (2003) [Towards the positional cloning of a spikelet identity gene frizzle panicle (FZP) in rice (Oryza sativa L.)].Yi chuan xue bao = Acta genetica Sinica 30: 9.</ref>
<ref name="pmid:24486766">Aya, K; Hobo, T; Sato-Izawa, K; Ueguchi-Tanaka, M; Kitano, H; Matsuoka, M. (2014) A Novel AP2-Type Transcription Factor, SMALL ORGAN SIZE1, Controls Organ Size Downstream of an Auxin Signaling Pathway.Plant & cell physiology null: null.</ref>
+
<ref name="pmid:24486766">Aya, K; Hobo, T; Sato-Izawa, K; Ueguchi-Tanaka, M; Kitano, H; Matsuoka, M. (2014) A Novel AP2-Type Transcription Factor, SMALL ORGAN SIZE1, Controls Organ Size Downstream of an Auxin Signaling Pathway.Plant & cell physiology : .</ref>
 
<ref name="pmid:23705659">Chi, WC; Chen, YA; Hsiung, YC; Fu, SF; Chou, CH; Trinh, NN; Chen, YC; Huang, HJ. (2013) Autotoxicity mechanism of Oryza sativa: transcriptome response in rice roots exposed to ferulic acid.BMC genomics 14: 1.</ref>
 
<ref name="pmid:23705659">Chi, WC; Chen, YA; Hsiung, YC; Fu, SF; Chou, CH; Trinh, NN; Chen, YC; Huang, HJ. (2013) Autotoxicity mechanism of Oryza sativa: transcriptome response in rice roots exposed to ferulic acid.BMC genomics 14: 1.</ref>
<ref name="pmid:20017947">Zhu, QH; Upadhyaya, NM; Gubler, F; Helliwell, CA. (2009) Over-expression of miR172 causes loss of spikelet determinacy and floral organ abnormalities in rice (Oryza sativa).BMC plant biology 9: null.</ref>
+
<ref name="pmid:20017947">Zhu, QH; Upadhyaya, NM; Gubler, F; Helliwell, CA. (2009) Over-expression of miR172 causes loss of spikelet determinacy and floral organ abnormalities in rice (Oryza sativa).BMC plant biology 9: .</ref>
 
<ref name="pmid:22987115">Huang, TL; Nguyen, QT; Fu, SF; Lin, CY; Chen, YC; Huang, HJ. (2012) Transcriptomic changes and signalling pathways induced by arsenic stress in rice roots.Plant molecular biology 80: 6.</ref>
 
<ref name="pmid:22987115">Huang, TL; Nguyen, QT; Fu, SF; Lin, CY; Chen, YC; Huang, HJ. (2012) Transcriptomic changes and signalling pathways induced by arsenic stress in rice roots.Plant molecular biology 80: 6.</ref>
 
<ref name="pmid:21169347">Sharoni, AM; Nuruzzaman, M; Satoh, K; Shimizu, T; Kondoh, H; Sasaya, T; Choi, IR; Omura, T; Kikuchi, S. (2011) Gene structures, classification and expression models of the AP2/EREBP transcription factor family in rice.Plant & cell physiology 52: 2.</ref>
 
<ref name="pmid:21169347">Sharoni, AM; Nuruzzaman, M; Satoh, K; Shimizu, T; Kondoh, H; Sasaya, T; Choi, IR; Omura, T; Kikuchi, S. (2011) Gene structures, classification and expression models of the AP2/EREBP transcription factor family in rice.Plant & cell physiology 52: 2.</ref>

Revision as of 01:37, 13 May 2014

Please input one-sentence summary here.

Annotated Information

Function

The ethylene response factor (ERF) family are members of the APETALA2 (AP2)/ERF transcription factor superfamily; they are known to play an important role in plant adaptation to biotic and abiotic stress[1].

The most abundant miRNA was E. pusilla miR156 (epu-miR156), orthologs of which work to maintain the vegetative phase by repressing the expression of the SQUAMOSA promoter-binding-like (SPL) transcription factors[2].

The SHAT1 gene, which encodes an APETALA2 transcription factor, is required for seed shattering through specifying abscission zone (AZ) development in rice[3].

The orchid Erycina pusilla has a short life cycle and relatively low chromosome number, making it a potential model plant for orchid functional genomics[2].

Approximately 200 confirmed positive colonies were obtained from screening 10(6) yeast colonies, and sequence analysis of conserved domains identified 75 independent cDNAs, 20 of which encoded plant TFs or co-activators, including members of the APETALA2 (AP2)/ethylene-responsive element-binding protein (EREBP), MYB and growth-regulating factor (GRF) families[4].

Lighting plays an important regulatory role and is intertwined with hypoxia conditions; both stimuli may act collaboratively to regulate the hypoxic response[5].

As AP2 is known to play an important role in the floral development, we took it as the most possible candidate of FZP[6].

SMOS1 encodes an unusual APETALA2 (AP2)-type transcription factor with an imperfect AP2 domain, and its product belongs to the basal AINTEGUMENTA (ANT) lineage, including WRINKLED1 (WRI1) and ADAP[7].

Autotoxicity plays an important role in regulating crop yield and quality[8].

miR172 is a conserved miRNA family which has been shown to regulate expression of APETALA2 (AP2)-like transcription factors in Arabidopsis and maize[9].

A Novel AP2-Type Transcription Factor, SMALL ORGAN SIZE1, Controls Organ Size Downstream of an Auxin Signaling Pathway[7].

Genes involved in secondary cell wall biogenesis, cell cycle and oligopeptide transport were mainly downregulated[10].

The phenotypes resulting from over-expression of miR172b suggests it represses SNB and at least one of the other miR172 targets, most likely Os03g60430, indicating roles for other AP2-like genes in rice floret development[9].

Conserved amino acid residues and phylogeny construction using the AP2/ERF conserved domain sequence suggest that in rice the OsAP2/EREBP gene family can be classified broadly into four subfamilies [AP2, RAV (related to ABI3/VP1), DREB (dehydration-responsive element-binding protein) and ERF (ethylene-responsive factor)][11].

Catalog of Erycina pusilla miRNA and categorization of reproductive phase-related miRNAs and their target gene families[2].

An efficient yeast-based system was developed for the isolation of plant cDNAs encoding transcription factors (TFs) and proteins with transcription activation functions (co-activators)[4].

Ferulic acid upregulated ATP-binding cassette and amino acid/auxin permease transporters as well as genes encoding signaling components such as leucine-rich repeat VIII and receptor-like cytoplasmic kinases VII protein kinases, APETALA2/ethylene response factor, WRKY, MYB and Zinc-finger protein expressed in inflorescence meristem transcription factors[8].

Genes encoding signalling components such as receptor-like cytoplasmic kinases protein kinase, APETALA2/ethylene response factor, heat shock factor, MYB and zinc-finger protein expressed in inflorescence meristem transcription factors were increased in expression[10].

The submergence tolerance regulator Sub1A mediates stress-responsive expression of AP2/ERF transcription factors[12].

The APETALA-2-like transcription factor OsAP2-39 controls key interactions between abscisic acid and gibberellin in rice[13].

Gene structures, classification and expression models of the AP2/EREBP transcription factor family in rice[11].

In addition to the most highly conserved APETALA2/ERF DNA-binding domain, the encoded protein contained an N-terminal MCGGAIL signature sequence, a putative nuclear localization sequence, and a C-terminal acidic transcription activation domain containing a novel mammalian hemopexin domain signature-like sequence[14].

Moreover, the WRKY and Myb TFs and LRR-VIII and SD-2b kinases might regulate downstream genes under FA stress but not general allelochemical stress[8].

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

  1. Yan, HW; Hong, L; Zhou, YQ; Jiang, HY; Zhu, SW; Fan, J; Cheng, BJ. (2013) A genome-wide analysis of the ERF gene family in sorghum.Genetics and molecular research : GMR 12: 2.
  2. 2.0 2.1 2.2 Lin, CS; Chen, JJ; Huang, YT; Hsu, CT; Lu, HC; Chou, ML; Chen, LC; Ou, CI; Liao, DC; Yeh, YY; Chang, SB; Shen, SC; Wu, FH; Shih, MC; Chan, MT. (2013) Catalog of Erycina pusilla miRNA and categorization of reproductive phase-related miRNAs and their target gene families.Plant molecular biology 82: 1-2.
  3. Zhou, Y; Lu, D; Li, C; Luo, J; Zhu, BF; Zhu, J; Shangguan, Y; Wang, Z; Sang, T; Zhou, B; Han, B. (2012) Genetic control of seed shattering in rice by the APETALA2 transcription factor shattering abortion1.The Plant cell 24: 3.
  4. 4.0 4.1 Ye, R; Yao, QH; Xu, ZH; Xue, HW. (2004) Development of an efficient method for the isolation of factors involved in gene transcription during rice embryo development.The Plant journal : for cell and molecular biology 38: 2.
  5. Hinz, M; Wilson, IW; Yang, J; Buerstenbinder, K; Llewellyn, D; Dennis, ES; Sauter, M; Dolferus, R. (2010) Arabidopsis RAP2.2: an ethylene response transcription factor that is important for hypoxia survival.Plant physiology 153: 2.
  6. Liu, HQ; Wu, WR; Duan, YL; Guan, HZ; Chen, J; Li, WM; Xue, YB. (2003) [Towards the positional cloning of a spikelet identity gene frizzle panicle (FZP) in rice (Oryza sativa L.)].Yi chuan xue bao = Acta genetica Sinica 30: 9.
  7. 7.0 7.1 Aya, K; Hobo, T; Sato-Izawa, K; Ueguchi-Tanaka, M; Kitano, H; Matsuoka, M. (2014) A Novel AP2-Type Transcription Factor, SMALL ORGAN SIZE1, Controls Organ Size Downstream of an Auxin Signaling Pathway.Plant & cell physiology : .
  8. 8.0 8.1 8.2 Chi, WC; Chen, YA; Hsiung, YC; Fu, SF; Chou, CH; Trinh, NN; Chen, YC; Huang, HJ. (2013) Autotoxicity mechanism of Oryza sativa: transcriptome response in rice roots exposed to ferulic acid.BMC genomics 14: 1.
  9. 9.0 9.1 Zhu, QH; Upadhyaya, NM; Gubler, F; Helliwell, CA. (2009) Over-expression of miR172 causes loss of spikelet determinacy and floral organ abnormalities in rice (Oryza sativa).BMC plant biology 9: .
  10. 10.0 10.1 Huang, TL; Nguyen, QT; Fu, SF; Lin, CY; Chen, YC; Huang, HJ. (2012) Transcriptomic changes and signalling pathways induced by arsenic stress in rice roots.Plant molecular biology 80: 6.
  11. 11.0 11.1 Sharoni, AM; Nuruzzaman, M; Satoh, K; Shimizu, T; Kondoh, H; Sasaya, T; Choi, IR; Omura, T; Kikuchi, S. (2011) Gene structures, classification and expression models of the AP2/EREBP transcription factor family in rice.Plant & cell physiology 52: 2.
  12. Jung, KH; Seo, YS; Walia, H; Cao, P; Fukao, T; Canlas, PE; Amonpant, F; Bailey-Serres, J; Ronald, PC. (2010) The submergence tolerance regulator Sub1A mediates stress-responsive expression of AP2/ERF transcription factors.Plant physiology 152: 3.
  13. Yaish, MW; El-Kereamy, A; Zhu, T; Beatty, PH; Good, AG; Bi, YM; Rothstein, SJ. (2010) The APETALA-2-like transcription factor OsAP2-39 controls key interactions between abscisic acid and gibberellin in rice.PLoS genetics 6: 9.
  14. Jung, J; Won, SY; Suh, SC; Kim, H; Wing, R; Jeong, Y; Hwang, I; Kim, M. (2007) The barley ERF-type transcription factor HvRAF confers enhanced pathogen resistance and salt tolerance in Arabidopsis.Planta 225: 3.

Structured Information

Gene Name

Os01g0131600

Description

Similar to AP2 domain containing protein RAP2.6 (Fragment)

Version

NM_001048461.1 GI:115434335 GeneID:4325981

Length

2047 bp

Definition

Oryza sativa Japonica Group Os01g0131600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:1745423..1747469

Sequence Coding Region

1746088..1747104

Expression

GEO Profiles:Os01g0131600

Genome Context

<gbrowseImage1> name=NC_008394:1745423..1747469 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:1745423..1747469 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggccccttccaagcagcagcagatgctcctcaagaaggtgatggcgaagaagcccaagacgaagaggctatccgggtttggccttaaaccctctgctgctttctccaggccccatgtgccgtcggcggcggcctccctgcagccaagccgtcgcgtccgcgtcgtgttcgaggaccctgacgcgacggactccgactctgacgacgacgaggacgccggcgccgcctcaaagaagcgctactttgagctcttcattggcaagccagcttcgtcgacgaagcaggcctctccggcgtccaccgtcgctgcctacgccaacatcggcaaggttgggagcacctgctaccgtggtgtgcgcctccggaagtggggcaagtgggcggcggagatccgcaaccccttcaccggccatagggagtggcttggcacctttgacactgctgatgcggcctccgccgcctaccagtctgcctcccgcaacttcgccgaagagaagcgccgccgtggtgtggcctcctctgcctcacctgctagttcggcgacccctactccgactgcgtcctcgtcgtcctcgacttctgccgcgccattcgcccacccttcgccgtcgtctgtgctcgaagccaccaagccagctccaaagccagagtcgccgccgctgccggagcaagctgcaactcccctcctggtggaggctaccaacgagaccgccgagctgccggatgacccagagttctacaaggatatactgcgcggtctacagctgccggacattgacccgatggatttccgagctgggctggatgctctggatatctccgatgtgccggcttacatgaatggcgaacaagacgtactcttcactgaggacatgctgcttggagacttcgctgaagaagatgacctcgacctcgacgacatcggtgatgacttctgcgaggatttcccagagatacccagcggctacgacttcggccgtggtgatatgttccggcaggtggatttctgcgtgtga</cdnaseq>

Protein Sequence

<aaseq>MAPSKQQQMLLKKVMAKKPKTKRLSGFGLKPSAAFSRPHVPSAA ASLQPSRRVRVVFEDPDATDSDSDDDEDAGAASKKRYFELFIGKPASSTKQASPASTV AAYANIGKVGSTCYRGVRLRKWGKWAAEIRNPFTGHREWLGTFDTADAASAAYQSASR NFAEEKRRRGVASSASPASSATPTPTASSSSSTSAAPFAHPSPSSVLEATKPAPKPES PPLPEQAATPLLVEATNETAELPDDPEFYKDILRGLQLPDIDPMDFRAGLDALDISDV PAYMNGEQDVLFTEDMLLGDFAEEDDLDLDDIGDDFCEDFPEIPSGYDFGRGDMFRQV DFCV</aaseq>

Gene Sequence

<dnaseqindica>666..1682#gctcctctcgccgttttggtcggggttttagcgagcgcgtgggaggccggaggcgacgacgacgaccgcgccgccgtcggagaagaaggccgcggaagcaccagtaccagcacccgtatatgtcttctagccccttctccgatctggtggtagtcgtgctcctcgtctgcgccgtcgtcgccgcagccgtcctcctccccctcgtctgcgcccgccgatctatgcaccagaggctccacggctggaacaagtccacgtcgatgctcaggtgcgtccgggtgccccttccccaccgtgaaatttttcatctttggcgaggtttacgccgatctggagtggatttgaccgggtttcgcggccggttcgtccagatctggagggttcttggtgggtttttgtggggtttttgattgatgggtttgtttctcgtctgtgattttgcagggacgggttcggggtcaagtattccgggttcctccacataaggccgtgtggtttctgtcgaggagattgacggattcgatcgattcgtgttcgtctccgtcaaatttttgcacaagagaaaaaaaaagtttcccccttttagagtttttccccttcagttttgtcagttttggtgaggaattttagagttcttttccggcaagagttagaagaagagagaaatggccccttccaagcagcagcagatgctcctcaagaaggtgatggcgaagaagcccaagacgaagaggctatccgggtttggccttaaaccctctgctgctttctccaggccccatgtgccgtcggcggcggcctccctgcagccaagccgtcgcgtccgcgtcgtgttcgaggaccctgacgcgacggactccgactctgacgacgacgaggacgccggcgccgcctcaaagaagcgctactttgagctcttcattggcaagccagcttcgtcgacgaagcaggcctctccggcgtccaccgtcgctgcctacgccaacatcggcaaggttgggagcacctgctaccgtggtgtgcgcctccggaagtggggcaagtgggcggcggagatccgcaaccccttcaccggccatagggagtggcttggcacctttgacactgctgatgcggcctccgccgcctaccagtctgcctcccgcaacttcgccgaagagaagcgccgccgtggtgtggcctcctctgcctcacctgctagttcggcgacccctactccgactgcgtcctcgtcgtcctcgacttctgccgcgccattcgcccacccttcgccgtcgtctgtgctcgaagccaccaagccagctccaaagccagagtcgccgccgctgccggagcaagctgcaactcccctcctggtggaggctaccaacgagaccgccgagctgccggatgacccagagttctacaaggatatactgcgcggtctacagctgccggacattgacccgatggatttccgagctgggctggatgctctggatatctccgatgtgccggcttacatgaatggcgaacaagacgtactcttcactgaggacatgctgcttggagacttcgctgaagaagatgacctcgacctcgacgacatcggtgatgacttctgcgaggatttcccagagatacccagcggctacgacttcggccgtggtgatatgttccggcaggtggatttctgcgtgtgaattaagagcttgctaaagttattcatgttggtgtgatgggcctgtgagtgtgggtgcttgggaggagatttcttgggttttttccccgagcaaaatcaatctgctcgtgcccttgagatttcagttccgcccataagaactccaacgcacatttagcattcggagagtaattttgttaggttaaaagtatggtaagttataggtggtatgttatgtttttctttttcttttctcaatgttatctggtacctaagtttgtcaagaaaatcatagtggacaagtcaagtatttggggctgtcgtctctgttatggaaagaaaaataagttttgattacattacatatcttttgctctcgagatctgg</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0131600, RefSeq:Os01g0131600