Difference between revisions of "Os03g0706500"
(→Function) |
(→Function) |
||
| Line 3: | Line 3: | ||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | [[File:The_locus_of_OsTB1.png|right|thumb|150px|''The structure of the chromosomal region encompassing the OsTB1 gene.'']] | + | [[File:The_locus_of_OsTB1.png|right|thumb|150px|''The structure of the chromosomal region encompassing the OsTB1 gene(from reference <ref name="4" />).'']] |
| − | [[File:OsTB1.png |right|thumb|150px|''Model of the OsMADS57-and OsTB1-mediated network for control of tillering'']] | + | [[File:OsTB1.png |right|thumb|150px|''Model of the OsMADS57-and OsTB1-mediated network for control of tillering(from reference <ref name="NATURE rice-1" />).'']] |
| − | The rice ''TB1'' gene ''(OsTB1)'' was first identified based on its sequence similarity with maize ''TEOSINTE BRANCHED 1 (TB1)'' which is involved in lateral branching in maize. Both genes encode putative transcription factors carrying a basic helix-loop-helix type of DNA-binding motif, named the TCP domain. The deduced amino acid sequence of the ''OsTB1'' ORF comprises 388 amino acid residues that is a member of the TCP family of transcription factors | + | The rice ''TB1'' gene ''(OsTB1)'' was first identified based on its sequence similarity with maize ''TEOSINTE BRANCHED 1 (TB1)'' which is involved in lateral branching in maize. Both genes encode putative transcription factors carrying a basic helix-loop-helix type of DNA-binding motif, named the TCP domain<ref name="4" />. The deduced amino acid sequence of the ''OsTB1'' ORF comprises 388 amino acid residues that is a member of the TCP family of transcription factors<ref name="3" />. Note that the in-frame stop codon was found two codons upstream of the deduced first methionine, suggesting that the methionine is used as an initiation codon. The DNA fragment also contains 1261-and 1198-bp 5 'and 3'-non-coding regions, respectively. The OsTB1 protein contains three significant sequence motifs, the SP, TCP and R domains. The R domain contains basic amino acid residues and is conserved in subpopulations of the TCP family. The SP domain contains a number of serine and proline residues, and is found in a limited number of members whose primary structures entirely match that of ''TB1''. Although the precise molecular functions of these domains except for the TCP domain remain unknown, the close resemblance of the primary structures of ''OsTB1'' and maize ''TB1'' together with the entire sequences strongly suggests that the biological function of ''OsTB1'' is similar to that of maize ''TB1''. A series of genetic and reverse-genetic analyses thus conducted indicated that ''OsTB1'' is a negative regulator for lateral branching in rice<ref name="NATURE rice-1 3 4" />. |
| − | The OsMADS57 protein negatively regulates the expression of ''D14'' functioning in strigolactone(SL) signalling to control tillering. This negative regulation by ''OsMADS57'' is suppressed by interaction with ''OsTB1'', leading to the balanced expression of ''D14'' for tillering. | + | The OsMADS57 protein negatively regulates the expression of ''D14'' functioning in strigolactone(SL) signalling to control tillering. This negative regulation by ''OsMADS57'' is suppressed by interaction with ''OsTB1'', leading to the balanced expression of ''D14'' for tillering<ref name="NATURE rice-1" />. |
===Expression=== | ===Expression=== | ||
Revision as of 07:16, 13 May 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
The rice TB1 gene (OsTB1) was first identified based on its sequence similarity with maize TEOSINTE BRANCHED 1 (TB1) which is involved in lateral branching in maize. Both genes encode putative transcription factors carrying a basic helix-loop-helix type of DNA-binding motif, named the TCP domainCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title. The deduced amino acid sequence of the OsTB1 ORF comprises 388 amino acid residues that is a member of the TCP family of transcription factorsCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title. Note that the in-frame stop codon was found two codons upstream of the deduced first methionine, suggesting that the methionine is used as an initiation codon. The DNA fragment also contains 1261-and 1198-bp 5 'and 3'-non-coding regions, respectively. The OsTB1 protein contains three significant sequence motifs, the SP, TCP and R domains. The R domain contains basic amino acid residues and is conserved in subpopulations of the TCP family. The SP domain contains a number of serine and proline residues, and is found in a limited number of members whose primary structures entirely match that of TB1. Although the precise molecular functions of these domains except for the TCP domain remain unknown, the close resemblance of the primary structures of OsTB1 and maize TB1 together with the entire sequences strongly suggests that the biological function of OsTB1 is similar to that of maize TB1. A series of genetic and reverse-genetic analyses thus conducted indicated that OsTB1 is a negative regulator for lateral branching in rice[2].
The OsMADS57 protein negatively regulates the expression of D14 functioning in strigolactone(SL) signalling to control tillering. This negative regulation by OsMADS57 is suppressed by interaction with OsTB1, leading to the balanced expression of D14 for tillering[1].
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os03g0706500 |
|---|---|
| Description |
TCP transcription factor family protein |
| Version |
NM_001057563.1 GI:115454854 GeneID:4333856 |
| Length |
1935 bp |
| Definition |
Oryza sativa Japonica Group Os03g0706500, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 3:29188933..29190867 |
| Sequence Coding Region |
29189438..29190604 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008396:29188933..29190867 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008396:29188933..29190867 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgcttcctttcttcgattccccaagccccatggacataccgctttaccaacagcttcagctcacccctccctctccaaagcccgaccaccaccaccaccaccattccaccttcttctactaccaccaccacccacctccctccccttccttcccctccttcccctcccccgccgccgccacgatcgcctcgccgtcgccggccatgcaccccttcatggacttggagttggagccgcatgggcagcagctggcggcggcggaggaggacggggcaggcgggcaaggcgtcgacgccggggtgcccttcggcgtcgacggagcggcggcggccgcggcggcgaggaaggaccggcacagcaagataagcaccgccggcgggatgagggaccggcggatgcggctgtccctcgacgtcgcccgcaagttcttcgcgctccaggacatgctcggcttcgacaaggccagcaagacggtgcaatggctcctcaacatgtccaaggccgccatccgggagatcatgagcgacgacgcctcctccgtctgcgaggaggacggctccagcagcctctccgtcgacggcaagcagcagcagcacagcaacccggcggatcggggcggcggcgccggggaccacaagggcgccgctcacggccacagcgacgggaagaagccggccaagccgagaagggcagcggccaacccgaagccaccgcggcggctggccaatgcgcaccccgtccccgacaaggagtcgcgcgccaaggcgagggagcgggcgcgggagcggaccaaggagaagaaccggatgcggtgggtcaccctcgcctcggcaatcagcgtcgaggcggccaccgcggcggcggccgcgggggaggacaagtcgccgacgagccccagcaacaacctgaaccactcatcgtccaccaatcttgtgagcaccgaattggaggacggctcctcgtcaacgcgccacaacggcgtcggcgtcagcggcggccggatgcaagaaatctcggcggctagcgaggcgagcgacgtgatcatggcgttcgccaacggcggcgcgtacggcgacagcggcagctactacctgcagcagcagcatcagcaggatcagtgggagctcggcggcgtcgtctacgccaattcgcggcactactgctga</cdnaseq> |
| Protein Sequence |
<aaseq>MLPFFDSPSPMDIPLYQQLQLTPPSPKPDHHHHHHSTFFYYHHH PPPSPSFPSFPSPAAATIASPSPAMHPFMDLELEPHGQQLAAAEEDGAGGQGVDAGVP FGVDGAAAAAAARKDRHSKISTAGGMRDRRMRLSLDVARKFFALQDMLGFDKASKTVQ WLLNMSKAAIREIMSDDASSVCEEDGSSSLSVDGKQQQHSNPADRGGGAGDHKGAAHG HSDGKKPAKPRRAAANPKPPRRLANAHPVPDKESRAKARERARERTKEKNRMRWVTLA SAISVEAATAAAAAGEDKSPTSPSNNLNHSSSTNLVSTELEDGSSSTRHNGVGVSGGR MQEISAASEASDVIMAFANGGAYGDSGSYYLQQQHQQDQWELGGVVYANSRHYC</aaseq> |
| Gene Sequence |
<dnaseqindica>506..1672#aagatggcaacaccctgatctctagcttagctgcagaggggagaggaacctcacatccaaactcctagctacaacttgtactagcatcctaagcaaccaagcacaaccaaagcaagcaagcacgaacaattctttcttcctctctacctctagctgctgcctgcctcctaatcctcctacccaccactccacatgagcccatgctgtgtgcctgtgtctgtgtgtgtgttctactcctaccatgagagaagagaccaagcatcaaccaagctagctagctcgtcctctcctcgatctctacttctctctcccacacaagctgagcgcccaggtaggctgcctgctaggtctcgtgcatggccggacacatctgatcatagcccactacggcactattccccccttccgcctcgcacgctgagaggtggccggagagggagggaggccagcgagcagcagtagcagcagcaacgcggctaggagtaaggagtcccatcagtaaagcatgcttcctttcttcgattccccaagccccatggacataccgctttaccaacagcttcagctcacccctccctctccaaagcccgaccaccaccaccaccaccattccaccttcttctactaccaccaccacccacctccctccccttccttcccctccttcccctcccccgccgccgccacgatcgcctcgccgtcgccggccatgcaccccttcatggacttggagttggagccgcatgggcagcagctggcggcggcggaggaggacggggcaggcgggcaaggcgtcgacgccggggtgcccttcggcgtcgacggagcggcggcggccgcggcggcgaggaaggaccggcacagcaagataagcaccgccggcgggatgagggaccggcggatgcggctgtccctcgacgtcgcccgcaagttcttcgcgctccaggacatgctcggcttcgacaaggccagcaagacggtgcaatggctcctcaacatgtccaaggccgccatccgggagatcatgagcgacgacgcctcctccgtctgcgaggaggacggctccagcagcctctccgtcgacggcaagcagcagcagcacagcaacccggcggatcggggcggcggcgccggggaccacaagggcgccgctcacggccacagcgacgggaagaagccggccaagccgagaagggcagcggccaacccgaagccaccgcggcggctggccaatgcgcaccccgtccccgacaaggagtcgcgcgccaaggcgagggagcgggcgcgggagcggaccaaggagaagaaccggatgcggtgggtcaccctcgcctcggcaatcagcgtcgaggcggccaccgcggcggcggccgcgggggaggacaagtcgccgacgagccccagcaacaacctgaaccactcatcgtccaccaatcttgtgagcaccgaattggaggacggctcctcgtcaacgcgccacaacggcgtcggcgtcagcggcggccggatgcaagaaatctcggcggctagcgaggcgagcgacgtgatcatggcgttcgccaacggcggcgcgtacggcgacagcggcagctactacctgcagcagcagcatcagcaggatcagtgggagctcggcggcgtcgtctacgccaattcgcggcactactgctgatgtgatcatccatccacacacgaacgaacgaacgaacggtacggcactaagatcgaactcctgcagctacataattatcctttgcttctcaagagtaataattcttgacgtgttaattaatccgggtgtgtattaattccctctttattattttttctcgcgtttatccggagttgactgtggtgaagacgaactttggtttggtcatcgcatggtgtgcattgcatatatagctagcactatcgtctgatcgatgattcatc</dnaseqindica> |
| External Link(s) |