Difference between revisions of "Os02g0610500"
(→Expression) |
(→Labs working on this gene) |
||
| Line 15: | Line 15: | ||
==Labs working on this gene== | ==Labs working on this gene== | ||
| − | + | *Department of Life Science, Pohang University of Science and Technology (POSTECH), Pohang 790–784, Korea | |
| − | + | *Crop Biotech Institute, Kyung Hee University, Yongin 446–701, Korea | |
| − | + | *Department of Plant Systems Biotech, Kyung Hee University, Yongin 446–701, Korea | |
| − | + | *Gyeongsang National University, Korea | |
| − | + | *the Plant Functional Genomics Laboratory at the POSTECH | |
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
==References== | ==References== | ||
Revision as of 13:53, 14 May 2014
Please input one-sentence summary here.
Contents
Annotated Information
function
OsCOL4, a member of the CONSTANS-like (COL) family in rice.OsCOL4 is a constitutive repressorfunctioning upstream of Ehd1 and functions independently from previously reported flowering pathways. In osphyB mutants, OsCOL4 expression was decreased and osphyB oscol4 double mutants flowered at the same time as the osphyB single mutants,indicating OsCOL4 functions downstream of OsphyB
Expression
OsCOL4 nullmutants flowered early under short or long days. In contrast, OsCOL4 activation-tagging mutants (OsCOL4-D) flowered late in either environment. Transcripts of Ehd1, Hd3a, and RFT1 were increased in the oscol4 mutants, but reduced in the OsCOL4-D mutants. By comparison, levels of Hd1, OsID1, OsMADS50, OsMADS51, and OsMADS56 transcripts were not significantly changed in oscol4 or OsCOL4-D.In osphyB mutants, OsCOL4 expression was decreased and osphyB oscol4 double mutants flowered at the same time as the osphyB single mutants[2].
Evolution
Plants recognize environmental factors to determine flowering time. CONSTANS (CO) plays a central role in the photoperiod flowering pathway of Arabidopsis, and CO protein stability is modulated by photoreceptors. In the former, GIGANTEA (GI) activates CONSTANS (CO), which promotes Flowering Locus T (FT) expression (Fowler et al.,1999; Park et al., 1999; Samach et al., 2000; Yanovsky and Kay, 2002). The CO gene is a member of a B-box transcription factor family which contains a CCT (CO, CO-like, and TOC1) domain at the C-terminal end (Putterill et al., 1995; Borden, 1998; Robson et al., 2001).In rice, Hd1, an ortholog of CO, acts as a flowering promoter, and phytochromes repress Hd1 expression.The rice genome contains 16 OsCOL genes (Griffiths et al.,2003). Among them, Hd1 was identified first via QTL analyses (Yano et al., 2000). Two groups of rice COL proteins differ from those in Arabidopsis (Griffiths et al., 2003).
Labs working on this gene
- Department of Life Science, Pohang University of Science and Technology (POSTECH), Pohang 790–784, Korea
- Crop Biotech Institute, Kyung Hee University, Yongin 446–701, Korea
- Department of Plant Systems Biotech, Kyung Hee University, Yongin 446–701, Korea
- Gyeongsang National University, Korea
- the Plant Functional Genomics Laboratory at the POSTECH
References
Cite error: <ref> tag with name "ref3" defined in <references> is not used in prior text.
Structured Information
| Gene Name |
Os02g0610500 |
|---|---|
| Description |
Similar to CONSTANS-like protein CO9 (Fragment) |
| Version |
NM_001053934.1 GI:115447238 GeneID:4329950 |
| Length |
1469 bp |
| Definition |
Oryza sativa Japonica Group Os02g0610500, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 2:24847664..24849132 |
| Sequence Coding Region |
24847765..24848448,24848530..24848844 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008395:24847664..24849132 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008395:24847664..24849132 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggaggcggtggaggacaaggcgatggtgggagtgggaggagcggtggcggcggggtactcctcgtcgtcgtgggggttggggacgcgggcgtgcgactcgtgcggcggggaggcggcgcggctctactgccgcgcggacggggcgttcctgtgcgcccggtgcgacgcgcgggcgcacggcgccgggtcgcgccacgcgcgggtgtggctgtgcgaggtgtgcgagcacgcgcccgccgccgtcacgtgccgggcggacgccgcggcgctgtgcgccgcctgcgacgccgacatccactcggcgaacccgctcgcgcgcaggcacgagcgcctccccgtcgcgcccttcttcggcccgctcgccgacgcgccgcagcccttccccttctcccaggccgccgcggatgccgccgcggcgcgggaggaggatgcggatgatgaccggagcaacgaggccgaggcggcgtcgtggcttctccccgagcccgacgacaatagccacgaggatagcgccgcagccgccgacgcgttcttcgccgacaccggcgcgtacctcggcgtcgacctggacttcgcccggtccatggacggaatcaaggccatcggggtaccggtcgcgccgcccgagctggacctcaccgccggcagccttttctaccccgaacactccatggcccacagcttgtcgtcgtcggaggtcgcgatcgtaccggacgcgctgtcggcgggctcggcggcgccgcccatggtggtggtggtggcgagcaaggggaaggagagggaggcgcggctgatgcggtacagggagaagcgcaagaaccggcggttcgacaagaccatccggtacgcgtcccgcaaggcgtacgccgagacgcggccgcgcatcaagggccggttcgccaagcgcaccgccgacgccgacgacgacgacgaggcgccatgctcgccggcgttctccgccctcgccgcgtcggacggcgtcgtgccgtcgttctga</cdnaseq> |
| Protein Sequence |
<aaseq>MEAVEDKAMVGVGGAVAAGYSSSSWGLGTRACDSCGGEAARLYC RADGAFLCARCDARAHGAGSRHARVWLCEVCEHAPAAVTCRADAAALCAACDADIHSA NPLARRHERLPVAPFFGPLADAPQPFPFSQAAADAAAAREEDADDDRSNEAEAASWLL PEPDDNSHEDSAAAADAFFADTGAYLGVDLDFARSMDGIKAIGVPVAPPELDLTAGSL FYPEHSMAHSLSSSEVAIVPDALSAGSAAPPMVVVVASKGKEREARLMRYREKRKNRR FDKTIRYASRKAYAETRPRIKGRFAKRTADADDDDEAPCSPAFSALAASDGVVPSF</aaseq> |
| Gene Sequence |
<dnaseqindica>102..785#867..1181#gtgcccaacgcccaaaaaacacagccaaactccgcgagaaaccgagctgcgagcgagtgaaacgcaccacgcgccgagcggcaaagcgaagcgaagaagaaatggaggcggtggaggacaaggcgatggtgggagtgggaggagcggtggcggcggggtactcctcgtcgtcgtgggggttggggacgcgggcgtgcgactcgtgcggcggggaggcggcgcggctctactgccgcgcggacggggcgttcctgtgcgcccggtgcgacgcgcgggcgcacggcgccgggtcgcgccacgcgcgggtgtggctgtgcgaggtgtgcgagcacgcgcccgccgccgtcacgtgccgggcggacgccgcggcgctgtgcgccgcctgcgacgccgacatccactcggcgaacccgctcgcgcgcaggcacgagcgcctccccgtcgcgcccttcttcggcccgctcgccgacgcgccgcagcccttccccttctcccaggccgccgcggatgccgccgcggcgcgggaggaggatgcggatgatgaccggagcaacgaggccgaggcggcgtcgtggcttctccccgagcccgacgacaatagccacgaggatagcgccgcagccgccgacgcgttcttcgccgacaccggcgcgtacctcggcgtcgacctggacttcgcccggtccatggacggaatcaaggccatcggggtaccggtcgcgccgcccgagctggacctcaccgccggcagccttttctaccccgaacactccatggcccacagcgtaagcctcactaccacacagctagctctcgtcgatgctcatggcgcggcgttatgacatggtttcctacgcgttccgcagttgtcgtcgtcggaggtcgcgatcgtaccggacgcgctgtcggcgggctcggcggcgccgcccatggtggtggtggtggcgagcaaggggaaggagagggaggcgcggctgatgcggtacagggagaagcgcaagaaccggcggttcgacaagaccatccggtacgcgtcccgcaaggcgtacgccgagacgcggccgcgcatcaagggccggttcgccaagcgcaccgccgacgccgacgacgacgacgaggcgccatgctcgccggcgttctccgccctcgccgcgtcggacggcgtcgtgccgtcgttctgaggaaggacgtacgcacggtacggcgagtcggcgacgtgcgccgtcgtaattttggcgcgccccgtgcgcgcgtgcatgcgtgcgtgtgtgcgacgcatggccccgtgtgacatgaataatatgtacagtagtttttcatccatggacgtagtattctattgtactccttgtactcctactactcctcttctgcctaaccaaggcttgtacattaccatgggagtagctgtttttgcaaccgtgaccatggttcagtgcttcaagttcaagggcgttaatgttactgtc</dnaseqindica> |
| External Link(s) |