Difference between revisions of "Os02g0610500"

From RiceWiki
Jump to: navigation, search
(Evolution)
(References)
Line 28: Line 28:
 
<ref name="ref4">Griffiths, S., Dunford, R.P., Coupland, G. and Laurie, D.A. (2003) The evolution of CONSTANS-like gene families in barley, rice, and Arabidopsis. Plant Physiol. 131, 1855–1867</ref>
 
<ref name="ref4">Griffiths, S., Dunford, R.P., Coupland, G. and Laurie, D.A. (2003) The evolution of CONSTANS-like gene families in barley, rice, and Arabidopsis. Plant Physiol. 131, 1855–1867</ref>
 
<ref name="ref5">Yano, M., Katayose, Y., Ashikari, M. et al. (2000) Hd1, a major photoperiod sensitivity quantitative trait locus in rice, is closely related to the Arabidopsis flowering time gene CONSTANS. Plant Cell, 12, 24732483</ref>
 
<ref name="ref5">Yano, M., Katayose, Y., Ashikari, M. et al. (2000) Hd1, a major photoperiod sensitivity quantitative trait locus in rice, is closely related to the Arabidopsis flowering time gene CONSTANS. Plant Cell, 12, 24732483</ref>
 
+
<ref name="ref6">Griffiths, S., Dunford, R.P., Coupland, G. and Laurie, D.A. (2003) The evolution of CONSTANS-like gene families in barley, rice, and Arabidopsis. PlantPhysiol. 131, 1855–1867</ref>
 
==Structured Information==
 
==Structured Information==
 
{{JaponicaGene|
 
{{JaponicaGene|

Revision as of 15:02, 14 May 2014

Please input one-sentence summary here.

Annotated Information

function

Figure 1. Phenotypes of oscol4-1, oscol4-2, and WT at heading stage .(from reference)[1]).g

OsCOL4, a member of the CONSTANS-like (COL) family in rice.OsCOL4 is a constitutive repressorfunctioning upstream of Ehd1 and functions independently from previously reported flowering pathways. In osphyB mutants, OsCOL4 expression was decreased and osphyB oscol4 double mutants flowered at the same time as the osphyB single mutants,indicating OsCOL4 functions downstream of OsphyB.[1]

Expression

OsCOL4 null mutants flowered early under short or long days. In contrast, OsCOL4 activation-tagging mutants (OsCOL4-D) flowered late in either environment. Transcripts of Ehd1, Hd3a, and RFT1 were increased in the oscol4 mutants, but reduced in the OsCOL4-D mutants. By comparison, levels of Hd1, OsID1, OsMADS50, OsMADS51, and OsMADS56 transcripts were not significantly changed in oscol4 or OsCOL4-D.In osphyB mutants, OsCOL4 expression was decreased and osphyB oscol4 double mutants flowered at the same time as the osphyB single mutants[1]

Evolution

Plants recognize environmental factors to determine flowering time. CONSTANS (CO) plays a central role in the photoperiod flowering pathway of Arabidopsis, and CO protein stability is modulated by photoreceptor[1]s. In the former, GIGANTEA (GI) activates CONSTANS (CO), which promotes Flowering Locus T (FT) expression[2]. The CO gene is a member of a B-box transcription factor family which contains a CCT (CO, CO-like, and TOC1) domain at the C-terminal end[3] .In rice, Hd1, an ortholog of CO, acts as a flowering promoter, and phytochromes repress Hd1 expression.The rice genome contains 16 OsCOL genes [4]. Among them, Hd1 was identified first via QTL analyses [5]. Two groups of rice COL proteins differ from those in Arabidopsis [6].

Labs working on this gene

  • Department of Life Science, Pohang University of Science and Technology (POSTECH), Pohang 790–784, Korea
  • Crop Biotech Institute, Kyung Hee University, Yongin 446–701, Korea
  • Department of Plant Systems Biotech, Kyung Hee University, Yongin 446–701, Korea
  • Gyeongsang National University, Korea
  • the Plant Functional Genomics Laboratory at the POSTECH

References

<references> [1] [2] [3] [4] [5] [6]

Structured Information

Gene Name

Os02g0610500

Description

Similar to CONSTANS-like protein CO9 (Fragment)

Version

NM_001053934.1 GI:115447238 GeneID:4329950

Length

1469 bp

Definition

Oryza sativa Japonica Group Os02g0610500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:24847664..24849132

Sequence Coding Region

24847765..24848448,24848530..24848844

Expression

GEO Profiles:Os02g0610500

Genome Context

<gbrowseImage1> name=NC_008395:24847664..24849132 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:24847664..24849132 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggaggcggtggaggacaaggcgatggtgggagtgggaggagcggtggcggcggggtactcctcgtcgtcgtgggggttggggacgcgggcgtgcgactcgtgcggcggggaggcggcgcggctctactgccgcgcggacggggcgttcctgtgcgcccggtgcgacgcgcgggcgcacggcgccgggtcgcgccacgcgcgggtgtggctgtgcgaggtgtgcgagcacgcgcccgccgccgtcacgtgccgggcggacgccgcggcgctgtgcgccgcctgcgacgccgacatccactcggcgaacccgctcgcgcgcaggcacgagcgcctccccgtcgcgcccttcttcggcccgctcgccgacgcgccgcagcccttccccttctcccaggccgccgcggatgccgccgcggcgcgggaggaggatgcggatgatgaccggagcaacgaggccgaggcggcgtcgtggcttctccccgagcccgacgacaatagccacgaggatagcgccgcagccgccgacgcgttcttcgccgacaccggcgcgtacctcggcgtcgacctggacttcgcccggtccatggacggaatcaaggccatcggggtaccggtcgcgccgcccgagctggacctcaccgccggcagccttttctaccccgaacactccatggcccacagcttgtcgtcgtcggaggtcgcgatcgtaccggacgcgctgtcggcgggctcggcggcgccgcccatggtggtggtggtggcgagcaaggggaaggagagggaggcgcggctgatgcggtacagggagaagcgcaagaaccggcggttcgacaagaccatccggtacgcgtcccgcaaggcgtacgccgagacgcggccgcgcatcaagggccggttcgccaagcgcaccgccgacgccgacgacgacgacgaggcgccatgctcgccggcgttctccgccctcgccgcgtcggacggcgtcgtgccgtcgttctga</cdnaseq>

Protein Sequence

<aaseq>MEAVEDKAMVGVGGAVAAGYSSSSWGLGTRACDSCGGEAARLYC RADGAFLCARCDARAHGAGSRHARVWLCEVCEHAPAAVTCRADAAALCAACDADIHSA NPLARRHERLPVAPFFGPLADAPQPFPFSQAAADAAAAREEDADDDRSNEAEAASWLL PEPDDNSHEDSAAAADAFFADTGAYLGVDLDFARSMDGIKAIGVPVAPPELDLTAGSL FYPEHSMAHSLSSSEVAIVPDALSAGSAAPPMVVVVASKGKEREARLMRYREKRKNRR FDKTIRYASRKAYAETRPRIKGRFAKRTADADDDDEAPCSPAFSALAASDGVVPSF</aaseq>

Gene Sequence

<dnaseqindica>102..785#867..1181#gtgcccaacgcccaaaaaacacagccaaactccgcgagaaaccgagctgcgagcgagtgaaacgcaccacgcgccgagcggcaaagcgaagcgaagaagaaatggaggcggtggaggacaaggcgatggtgggagtgggaggagcggtggcggcggggtactcctcgtcgtcgtgggggttggggacgcgggcgtgcgactcgtgcggcggggaggcggcgcggctctactgccgcgcggacggggcgttcctgtgcgcccggtgcgacgcgcgggcgcacggcgccgggtcgcgccacgcgcgggtgtggctgtgcgaggtgtgcgagcacgcgcccgccgccgtcacgtgccgggcggacgccgcggcgctgtgcgccgcctgcgacgccgacatccactcggcgaacccgctcgcgcgcaggcacgagcgcctccccgtcgcgcccttcttcggcccgctcgccgacgcgccgcagcccttccccttctcccaggccgccgcggatgccgccgcggcgcgggaggaggatgcggatgatgaccggagcaacgaggccgaggcggcgtcgtggcttctccccgagcccgacgacaatagccacgaggatagcgccgcagccgccgacgcgttcttcgccgacaccggcgcgtacctcggcgtcgacctggacttcgcccggtccatggacggaatcaaggccatcggggtaccggtcgcgccgcccgagctggacctcaccgccggcagccttttctaccccgaacactccatggcccacagcgtaagcctcactaccacacagctagctctcgtcgatgctcatggcgcggcgttatgacatggtttcctacgcgttccgcagttgtcgtcgtcggaggtcgcgatcgtaccggacgcgctgtcggcgggctcggcggcgccgcccatggtggtggtggtggcgagcaaggggaaggagagggaggcgcggctgatgcggtacagggagaagcgcaagaaccggcggttcgacaagaccatccggtacgcgtcccgcaaggcgtacgccgagacgcggccgcgcatcaagggccggttcgccaagcgcaccgccgacgccgacgacgacgacgaggcgccatgctcgccggcgttctccgccctcgccgcgtcggacggcgtcgtgccgtcgttctgaggaaggacgtacgcacggtacggcgagtcggcgacgtgcgccgtcgtaattttggcgcgccccgtgcgcgcgtgcatgcgtgcgtgtgtgcgacgcatggccccgtgtgacatgaataatatgtacagtagtttttcatccatggacgtagtattctattgtactccttgtactcctactactcctcttctgcctaaccaaggcttgtacattaccatgggagtagctgtttttgcaaccgtgaccatggttcagtgcttcaagttcaagggcgttaatgttactgtc</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0610500, RefSeq:Os02g0610500

  1. 1.0 1.1 1.2 1.3 1.4 Yang-Seok Lee; Dong-Hoon Jeong; Dong-Yeon Lee;(2010)OsCOL4 is a constitutive flowering repressor upstream of Ehd1 and downstream of OsphyB The Plant Journal, 63(1): 18-30
  2. 2.0 2.1 Yanovsky, M.J. and Kay, S.A. (2002) Molecular basis of seasonal time measurement in Arabidopsis. Nature, 419, 308–312
  3. 3.0 3.1 Robson, F., Costa, M.M.R., Hepworth, S.R.. (2001) Functional importance of conserved domains in the flowering-time gene CONSTANS demonstrated by analysis of mutant alleles and transgenic plants. Plant J. 28, 619631
  4. 4.0 4.1 Griffiths, S., Dunford, R.P., Coupland, G. and Laurie, D.A. (2003) The evolution of CONSTANS-like gene families in barley, rice, and Arabidopsis. Plant Physiol. 131, 1855–1867
  5. 5.0 5.1 Yano, M., Katayose, Y., Ashikari, M. et al. (2000) Hd1, a major photoperiod sensitivity quantitative trait locus in rice, is closely related to the Arabidopsis flowering time gene CONSTANS. Plant Cell, 12, 24732483
  6. 6.0 6.1 Griffiths, S., Dunford, R.P., Coupland, G. and Laurie, D.A. (2003) The evolution of CONSTANS-like gene families in barley, rice, and Arabidopsis. PlantPhysiol. 131, 1855–1867