Difference between revisions of "Os10g0573400"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 5: Line 5:
 
Please input function information here.
 
Please input function information here.
  
This gene possesses most of the key protein functions of ABA-related genes and it is the common ancestor of many species such as ''A. thaliana'', ''Arabidopsis lyrata'', ''Populustrichocarpa'', ''Oryza sativa'', ''Selaginella moellendorffii'', and ''Physcomitrella patens''. In two species (''A. thaliana'' and ''O. sativa''), duplicate genes related to ABA signaling pathways contribute to the expression variation in different organs or stress responses.[[1]] Twelve ABA receptor orthologs named OsPYL1–12 in Oryza sativa (OsPYLs) are identified. OsPYL1 corresponds to Os10g0573400 which is showed in the following chaters.[[2]]
+
This gene possesses most of the key protein functions of ABA-related genes and it is the common ancestor of many species such as ''A. thaliana'', ''Arabidopsis lyrata'', ''Populustrichocarpa'', ''Oryza sativa'', ''Selaginella moellendorffii'', and ''Physcomitrella patens''. In two species (''A. thaliana'' and ''O. sativa''), duplicate genes related to ABA signaling pathways contribute to the expression variation in different organs or stress responses.[[1]] Twelve ABA receptor orthologs named OsPYL1–12 in Oryza sativa (OsPYLs) are identified. OsPYL1 corresponds to Os10g0573400 which is showed in the following chaters.[[2]]
[[File:1.jpg]]
 
  
 
===Expression===
 
===Expression===

Revision as of 05:29, 20 May 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

This gene possesses most of the key protein functions of ABA-related genes and it is the common ancestor of many species such as A. thaliana, Arabidopsis lyrata, Populustrichocarpa, Oryza sativa, Selaginella moellendorffii, and Physcomitrella patens. In two species (A. thaliana and O. sativa), duplicate genes related to ABA signaling pathways contribute to the expression variation in different organs or stress responses.1 Twelve ABA receptor orthologs named OsPYL1–12 in Oryza sativa (OsPYLs) are identified. OsPYL1 corresponds to Os10g0573400 which is showed in the following chaters.2

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os10g0573400

Description

Conserved hypothetical protein

Version

NM_001072002.1 GI:115483599 GeneID:4349472

Length

1089 bp

Definition

Oryza sativa Japonica Group Os10g0573400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 10

Location

Chromosome 10:23221607..23222695

Sequence Coding Region

23221741..23222379

Expression

GEO Profiles:Os10g0573400

Genome Context

<gbrowseImage1> name=NC_008403:23221607..23222695 source=RiceChromosome10 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008403:23221607..23222695 source=RiceChromosome10 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggagcagcaggaggaagtgccaccgccgccggcggggctggggctgacggcggaggagtacgcgcaggtgcgggcgacggtggaggcgcaccaccgctacgccgtggggccgggccaatgctcctccctcctcgcgcagcgcatccacgcgccgcccgccgccgtctgggccgtcgtccgccgcttcgactgcccccaggtgtacaagcacttcatccgcagctgcgtcctccggcccgacccccaccacgacgacaacggcaacgacctccgccccggccgcctccgcgaggtcagcgtcatctccggcctccccgccagcaccagcaccgagcgcctcgacctcctcgacgacgcccaccgcgtcttcggcttcaccatcaccggcggcgagcaccgcctccgcaactaccgatccgtcaccaccgtctcccagctcgacgagatctgcaccctcgtcctcgagtcctacatcgtcgacgtccccgacggcaacaccgaggacgacacccgcctcttcgccgacaccgtcatcaggctcaacctccagaagctcaagtccgtctccgaggccaacgccaacgccgctgccgccgccgccgctcctcctcctcctccaccggcggcggcggaatag</cdnaseq>

Protein Sequence

<aaseq>MEQQEEVPPPPAGLGLTAEEYAQVRATVEAHHRYAVGPGQCSSL LAQRIHAPPAAVWAVVRRFDCPQVYKHFIRSCVLRPDPHHDDNGNDLRPGRLREVSVI SGLPASTSTERLDLLDDAHRVFGFTITGGEHRLRNYRSVTTVSQLDEICTLVLESYIV DVPDGNTEDDTRLFADTVIRLNLQKLKSVSEANANAAAAAAAPPPPPPAAAE</aaseq>

Gene Sequence

<dnaseqindica>135..773#aaatcccaattccccatctggctcgctcgacatcttcttcactcctcacttcccccactttctctactcctagcatagcagcctcactttccctcctcgatcgaagcagcaggcggaggcggaggggatcggcgatggagcagcaggaggaagtgccaccgccgccggcggggctggggctgacggcggaggagtacgcgcaggtgcgggcgacggtggaggcgcaccaccgctacgccgtggggccgggccaatgctcctccctcctcgcgcagcgcatccacgcgccgcccgccgccgtctgggccgtcgtccgccgcttcgactgcccccaggtgtacaagcacttcatccgcagctgcgtcctccggcccgacccccaccacgacgacaacggcaacgacctccgccccggccgcctccgcgaggtcagcgtcatctccggcctccccgccagcaccagcaccgagcgcctcgacctcctcgacgacgcccaccgcgtcttcggcttcaccatcaccggcggcgagcaccgcctccgcaactaccgatccgtcaccaccgtctcccagctcgacgagatctgcaccctcgtcctcgagtcctacatcgtcgacgtccccgacggcaacaccgaggacgacacccgcctcttcgccgacaccgtcatcaggctcaacctccagaagctcaagtccgtctccgaggccaacgccaacgccgctgccgccgccgccgctcctcctcctcctccaccggcggcggcggaatagcctttttcttttctttttggacctctctgcaatttcacttctattcagggaggtgcttcgaatttgctccatgtctcatgaagttggaggaggaagggtcagcttctaatacatctcattcctggtggtgctgcctgtaataatctcttcatcttcttttttcctctcctcctcctcttctcttcctggatttcttttgcttggaatttttacttacctttgtgtgtgtgtctcacttcctgattggaatccatatttgcttttcggtggttttgttcttcattcaaattcaaattaatctatctagcatttgttc</dnaseqindica>

External Link(s)

NCBI Gene:Os10g0573400, RefSeq:Os10g0573400