Difference between revisions of "Os10g0573400"
Candyazhen (talk | contribs) (→Function) |
Candyazhen (talk | contribs) (→Function) |
||
| Line 5: | Line 5: | ||
Please input function information here. | Please input function information here. | ||
| − | This gene possesses most of the key protein functions of ABA-related genes and it is the common ancestor of many species such as ''A. thaliana'', ''Arabidopsis lyrata'', ''Populustrichocarpa'', ''Oryza sativa'', ''Selaginella moellendorffii'', and ''Physcomitrella patens''. In two species (''A. thaliana'' and ''O. sativa''), duplicate genes related to ABA signaling pathways contribute to the expression variation in different organs or stress responses.[[1]] Twelve ABA receptor orthologs named OsPYL1–12 in Oryza sativa (OsPYLs) are identified. OsPYL1 corresponds to Os10g0573400 which is showed in the following chaters.[[2 | + | This gene possesses most of the key protein functions of ABA-related genes and it is the common ancestor of many species such as ''A. thaliana'', ''Arabidopsis lyrata'', ''Populustrichocarpa'', ''Oryza sativa'', ''Selaginella moellendorffii'', and ''Physcomitrella patens''. In two species (''A. thaliana'' and ''O. sativa''), duplicate genes related to ABA signaling pathways contribute to the expression variation in different organs or stress responses.[[1]] Twelve ABA receptor orthologs named OsPYL1–12 in Oryza sativa (OsPYLs) are identified. OsPYL1 corresponds to Os10g0573400 which is showed in the following chaters.[[2]] |
| − | |||
===Expression=== | ===Expression=== | ||
Revision as of 05:29, 20 May 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
Please input function information here.
This gene possesses most of the key protein functions of ABA-related genes and it is the common ancestor of many species such as A. thaliana, Arabidopsis lyrata, Populustrichocarpa, Oryza sativa, Selaginella moellendorffii, and Physcomitrella patens. In two species (A. thaliana and O. sativa), duplicate genes related to ABA signaling pathways contribute to the expression variation in different organs or stress responses.1 Twelve ABA receptor orthologs named OsPYL1–12 in Oryza sativa (OsPYLs) are identified. OsPYL1 corresponds to Os10g0573400 which is showed in the following chaters.2
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os10g0573400 |
|---|---|
| Description |
Conserved hypothetical protein |
| Version |
NM_001072002.1 GI:115483599 GeneID:4349472 |
| Length |
1089 bp |
| Definition |
Oryza sativa Japonica Group Os10g0573400, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 10:23221607..23222695 |
| Sequence Coding Region |
23221741..23222379 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008403:23221607..23222695 source=RiceChromosome10 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008403:23221607..23222695 source=RiceChromosome10 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggagcagcaggaggaagtgccaccgccgccggcggggctggggctgacggcggaggagtacgcgcaggtgcgggcgacggtggaggcgcaccaccgctacgccgtggggccgggccaatgctcctccctcctcgcgcagcgcatccacgcgccgcccgccgccgtctgggccgtcgtccgccgcttcgactgcccccaggtgtacaagcacttcatccgcagctgcgtcctccggcccgacccccaccacgacgacaacggcaacgacctccgccccggccgcctccgcgaggtcagcgtcatctccggcctccccgccagcaccagcaccgagcgcctcgacctcctcgacgacgcccaccgcgtcttcggcttcaccatcaccggcggcgagcaccgcctccgcaactaccgatccgtcaccaccgtctcccagctcgacgagatctgcaccctcgtcctcgagtcctacatcgtcgacgtccccgacggcaacaccgaggacgacacccgcctcttcgccgacaccgtcatcaggctcaacctccagaagctcaagtccgtctccgaggccaacgccaacgccgctgccgccgccgccgctcctcctcctcctccaccggcggcggcggaatag</cdnaseq> |
| Protein Sequence |
<aaseq>MEQQEEVPPPPAGLGLTAEEYAQVRATVEAHHRYAVGPGQCSSL LAQRIHAPPAAVWAVVRRFDCPQVYKHFIRSCVLRPDPHHDDNGNDLRPGRLREVSVI SGLPASTSTERLDLLDDAHRVFGFTITGGEHRLRNYRSVTTVSQLDEICTLVLESYIV DVPDGNTEDDTRLFADTVIRLNLQKLKSVSEANANAAAAAAAPPPPPPAAAE</aaseq> |
| Gene Sequence |
<dnaseqindica>135..773#aaatcccaattccccatctggctcgctcgacatcttcttcactcctcacttcccccactttctctactcctagcatagcagcctcactttccctcctcgatcgaagcagcaggcggaggcggaggggatcggcgatggagcagcaggaggaagtgccaccgccgccggcggggctggggctgacggcggaggagtacgcgcaggtgcgggcgacggtggaggcgcaccaccgctacgccgtggggccgggccaatgctcctccctcctcgcgcagcgcatccacgcgccgcccgccgccgtctgggccgtcgtccgccgcttcgactgcccccaggtgtacaagcacttcatccgcagctgcgtcctccggcccgacccccaccacgacgacaacggcaacgacctccgccccggccgcctccgcgaggtcagcgtcatctccggcctccccgccagcaccagcaccgagcgcctcgacctcctcgacgacgcccaccgcgtcttcggcttcaccatcaccggcggcgagcaccgcctccgcaactaccgatccgtcaccaccgtctcccagctcgacgagatctgcaccctcgtcctcgagtcctacatcgtcgacgtccccgacggcaacaccgaggacgacacccgcctcttcgccgacaccgtcatcaggctcaacctccagaagctcaagtccgtctccgaggccaacgccaacgccgctgccgccgccgccgctcctcctcctcctccaccggcggcggcggaatagcctttttcttttctttttggacctctctgcaatttcacttctattcagggaggtgcttcgaatttgctccatgtctcatgaagttggaggaggaagggtcagcttctaatacatctcattcctggtggtgctgcctgtaataatctcttcatcttcttttttcctctcctcctcctcttctcttcctggatttcttttgcttggaatttttacttacctttgtgtgtgtgtctcacttcctgattggaatccatatttgcttttcggtggttttgttcttcattcaaattcaaattaatctatctagcatttgttc</dnaseqindica> |
| External Link(s) |
