Difference between revisions of "BGIOSGA024803"
(→Labs working on this gene) |
(→Annotated Information) |
||
| Line 1: | Line 1: | ||
BGIOSGA024803 gene derived from alleles of the generally cultivated evolution rice controls the prostrate growth of common wild rice, with the performance of upright growth and increasing spike grain number. | BGIOSGA024803 gene derived from alleles of the generally cultivated evolution rice controls the prostrate growth of common wild rice, with the performance of upright growth and increasing spike grain number. | ||
| − | + | ||
===Function=== | ===Function=== | ||
Please input function information here. | Please input function information here. | ||
Revision as of 11:46, 20 May 2014
BGIOSGA024803 gene derived from alleles of the generally cultivated evolution rice controls the prostrate growth of common wild rice, with the performance of upright growth and increasing spike grain number.
Contents
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
References
Please input cited references here.
Structured Information
| Gene Name |
BGIOSGA024803 |
|---|---|
| Description |
Prostrate growth 1Putative uncharacterized protein |
| Definition |
Oryza sativa Indica Group BGIOSGA024803, complete gene. |
| LocusTag |
OSJNBB0050B07.12 |
| Ensembl Transcript ID |
BGIOSGA024803-TA |
| Ensembl Protein ID |
BGIOSGA024803-PA |
| Length |
504 |
| Source |
Oryza sativa Indica Group ORGANISM Oryza sativa Indica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 7:2808627..2809130 |
| Sequence Coding Region |
2808627..2809130 |
| Genome Context |
<gbrowseImage1> name=IndicaChromosome07:2808627..2809130 source=RiceIndica07 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=IndicaChromosome07:2808627..2809130 source=RiceIndica07 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>ATGGATCCCTCATCGGCTTCTTGGCCGGCTCCGGCTTCTCCGCCGGTGGAGCTGTCCCTGTCCCTGCCGGCGGCGGCGGCGAGGAACCGCGACGAGGCGGCGCCGACGGCGATCGTCGACGGCAAGCAAGTGAGGCTGTTCCCGTGCCTCTTCTGCGCCAAGACGTTCCGCAAGTCGCAGGCGCTCGGCGGCCACCAGAACGCGCACCGGAAGGAGCGCGTCGCCGGCGGCAGCTGGAACCCCAACGTCTACGGCGACGGCGGCGGATCAGCGTCCATGCCCATCGCCTCCCATGGCGTCACGGCGGCGGGGAGTAGTACGGCAGCCGACGGCCGGTGGTGCGGCGGCGCTGCCAGCGACGACGACACAACGGCGGCGCCCATGCCTTCCCTCGGCTCAGGCTCGGCGGCGCTCGGCGCCGGCGCCGGTTTCGCTTCGACCGAAAGGGGCTCTTCCGGCGGCGGCGTCGCCGGCGAGGAGCTTGTCCTCGAGCTCGGCCTCTAG</cdnaseq> |
| Protein Sequence |
<aaseq>MDPSSASWPAPASPPVELSLSLPAAAARNRDEAAPTAIVDGKQVRLFPCLFCAKTFRKSQALGGHQNAHRKERVAGGSWNPNVYGDGGGSASMPIASHGVTAAGSSTAADGRWCGGAASDDDTTAAPMPSLGSGSAALGAGAGFASTERGSSGGGVAGEELVLELGL</aaseq> |
| Gene Sequence |
<dnaseqindica>1..504#ATGGATCCCTCATCGGCTTCTTGGCCGGCTCCGGCTTCTCCGCCGGTGGAGCTGTCCCTGTCCCTGCCGGCGGCGGCGGCGAGGAACCGCGACGAGGCGGCGCCGACGGCGATCGTCGACGGCAAGCAAGTGAGGCTGTTCCCGTGCCTCTTCTGCGCCAAGACGTTCCGCAAGTCGCAGGCGCTCGGCGGCCACCAGAACGCGCACCGGAAGGAGCGCGTCGCCGGCGGCAGCTGGAACCCCAACGTCTACGGCGACGGCGGCGGATCAGCGTCCATGCCCATCGCCTCCCATGGCGTCACGGCGGCGGGGAGTAGTACGGCAGCCGACGGCCGGTGGTGCGGCGGCGCTGCCAGCGACGACGACACAACGGCGGCGCCCATGCCTTCCCTCGGCTCAGGCTCGGCGGCGCTCGGCGCCGGCGCCGGTTTCGCTTCGACCGAAAGGGGCTCTTCCGGCGGCGGCGTCGCCGGCGAGGAGCTTGTCCTCGAGCTCGGCCTCTAG</dnaseqindica> |
| External Link(s) |
