Difference between revisions of "Os07g0129700"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 4: Line 4:
 
===Function===
 
===Function===
 
Please input function information here.
 
Please input function information here.
    OSH15 cDNA 1566 bp, contains five exons and encoding a 355 amino acid composition of protein products.Mutant d6 - tankanshirasasa and d6-1 is due to part of the loss of the exon 4 and exon 5  ;Mutant d6 - ID6 is because of missing part of a total of about 700 bp of exon 1 and 5 'UTR and 1 part of introns .(Sato et al., 1999)
+
OSH15 cDNA 1566 bp, contains five exons and encoding a 355 amino acid composition of protein products.Mutant d6 - tankanshirasasa and d6-1 is due to part of the loss of the exon 4 and exon 5  ;Mutant d6 - ID6 is because of missing part of a total of about 700 bp of exon 1 and 5 'UTR and 1 part of introns .(Sato et al., 1999)
 
    
 
    
    OSH15 encoding a protein containing homologous heterotypic structure domain.OSH15 might be responsible for decide the position of elongation internode of grassroots outside cells, control of small vascular bundle sheath, sclerenchyma and the growth of epidermal cells;OSH15 possible in two ways to control the morphology and differentiation of internodes cell: one is the OSH15 may adjust the intercalary meristem cell division rate of intercalary meristem and maintain the quarter life to influence the internode elongation;The second is OSH15 may as the development of dermal cells develop into thick wall switch (Sato et al., 1999)
+
OSH15 encoding a protein containing homologous heterotypic structure domain.OSH15 might be responsible for decide the position of elongation internode of grassroots outside cells, control of small vascular bundle sheath, sclerenchyma and the growth of epidermal cells;OSH15 possible in two ways to control the morphology and differentiation of internodes cell: one is the OSH15 may adjust the intercalary meristem cell division rate of intercalary meristem and maintain the quarter life to influence the internode elongation;The second is OSH15 may as the development of dermal cells develop into thick wall switch (Sato et al., 1999)
 
    
 
    
    KNOX homologous genes alien to maintaining culture cell in undifferentiated state is enough, on the stage of meristematic cells pending the formation and maintaining of has an important role.Reference OSH1 (Ito et al., 2001)   
+
KNOX homologous genes alien to maintaining culture cell in undifferentiated state is enough, on the stage of meristematic cells pending the formation and maintaining of has an important role.Reference OSH1 (Ito et al., 2001)   
 
      
 
      
    OSH a gene expression can induce transgenic rice leaf sheath of ectopic bud, their ectopic expression interfere with leaf development and to promote leaf is in a state of undifferentiated, reference OsH43 (Sentoku et al., 2000)
+
OSH a gene expression can induce transgenic rice leaf sheath of ectopic bud, their ectopic expression interfere with leaf development and to promote leaf is in a state of undifferentiated, reference OsH43 (Sentoku et al., 2000)
  
 
===Expression===
 
===Expression===

Revision as of 11:58, 20 May 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here. OSH15 cDNA 1566 bp, contains five exons and encoding a 355 amino acid composition of protein products.Mutant d6 - tankanshirasasa and d6-1 is due to part of the loss of the exon 4 and exon 5  ;Mutant d6 - ID6 is because of missing part of a total of about 700 bp of exon 1 and 5 'UTR and 1 part of introns .(Sato et al., 1999)

OSH15 encoding a protein containing homologous heterotypic structure domain.OSH15 might be responsible for decide the position of elongation internode of grassroots outside cells, control of small vascular bundle sheath, sclerenchyma and the growth of epidermal cells;OSH15 possible in two ways to control the morphology and differentiation of internodes cell: one is the OSH15 may adjust the intercalary meristem cell division rate of intercalary meristem and maintain the quarter life to influence the internode elongation;The second is OSH15 may as the development of dermal cells develop into thick wall switch (Sato et al., 1999)

KNOX homologous genes alien to maintaining culture cell in undifferentiated state is enough, on the stage of meristematic cells pending the formation and maintaining of has an important role.Reference OSH1 (Ito et al., 2001)

OSH a gene expression can induce transgenic rice leaf sheath of ectopic bud, their ectopic expression interfere with leaf development and to promote leaf is in a state of undifferentiated, reference OsH43 (Sentoku et al., 2000)

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here. 1. Yukihiro Ito;Nori Kurata

 Disruption of KNOX gene suppression in leaf by introducing its cDNA in rice
 Plant Science, 2008, 174(3): 357-365

2. Yukihiro Ito;Mitsugu Eiguchi;Nori Kurata

 KNOX homeobox genes are sufficient in maintaining cultured cells in an undifferentiated state in rice
 Genesis, 2001, 30(4): 231-238

3. Hiroshi Nagasaki;Tomoaki Sakamoto;Yutaka Sato;Makoto Matsuoka

 Functional Analysis of the Conserved Domains of a Rice KNOX Homeodomain Protein, OSH15
 The Plant Cell, 2001, 13(9): 2085-2098

4. Naoki Sentoku;Yutaka Sato;Makoto Matsuoka

 Overexpression of Rice OSH Genes Induces Ectopic Shoots on Leaf Sheaths of Transgenic Rice Plants
 Developmental Biology, 2000, 220(2): 358-364

5. A. Dorien Postma-Haarsma;Ira I.G.S. Verwoert;Oscar P. Stronk;Jan Koster;Gerda E.M. Lamers;J. Harry C. Hoge;Annemarie H. Meijer

 Characterization of the KNOX class homeobox genes Oskn2 and Oskn3 identified in a collection of cDNA libraries covering the early stages of rice embryogenesis
 Plant Molecular Biology, 1999, 39(2): 257-271

6. Yutaka Sato;Naoki Sentoku;Yoshio Miura;Hirohiko Hirochika;Hidemi Kitano and Makoto Matsuoka

 Loss-of-function mutations in the rice homeobox gene OSH15 affect the architecture of internodes resulting in dwarf plants
 The EMBO Journal, 1999, 18(4): 992-1002

7. Naoki Sentoku;Yutaka Sato;Nori Kurata;Yukihiro Ito;Hidemi Kitano;Makoto Matsuoka

 Regional Expression of the Rice KN1-Type Homeobox Gene Family during Embryo, Shoot, and Flower Development
 The Plant Cell, 1999, 11(9): 1651-1664

8. Yutaka Sato;Naoki Sentoku;Yasuo Nagato;Makoto Matsuoka

 Isolation and characterization of a rice homebox gene, OSH15
 Plant Molecular Biology, 1998, 38(6): 983-997

Structured Information

Gene Name

Os07g0129700

Description

OSH15 protein (Homeobox gene)

Version

NM_001065353.1 GI:115470438 GeneID:4342320

Length

6062 bp

Definition

Oryza sativa Japonica Group Os07g0129700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 7

Location

Chromosome 7:1598277..1604338

Sequence Coding Region

1598405..1598743,1598853..1598963,1599113..1599269,1603366..1603619,1603762..1603968

Expression

GEO Profiles:Os07g0129700

Genome Context

<gbrowseImage1> name=NC_008400:1598277..1604338 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008400:1598277..1604338 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggatcagagctttgggaatcttggaggaggaggaggagcaggggggagcggcaaggcggcggcgtcgtcgttcctgcagctgccgctgtccacggcggcggcggccaccgcgtactacggcacgccgctcgccttgcaccaggcggcggccgcggctggcccgtcgcagtaccacggtcacggtcacccccaccacggcggcggccaccaccacagcaagcacggcggcgccggtggtggggagatctcggcggcggaggccgagtccatcaaggccaagatcatggcgcacccccagtactccgccctcctcgcagcctacctcgactgccagaaagtcggagcgccgccggaggtgctggagaggctgaccgccacggcggcaaagctggacgcccgccctcccggccgccacgacgcgcgcgacccggagctcgaccagttcatggaggcgtactgcaacatgctggccaagtacagggaggagctgacgcggccgatcgacgaggccatggagttcctcaagagggtggagtcgcagctcgacaccatcgccggcggcgcccatggcggcggcgccggctcggcgcgcctcctcctcgccgatggtaaatctgaatgtgttggttcttctgaggatgacatggacccaagtggccgcgaaaacgagccgcctgagatcgacccgcgcgctgaggataaggagctcaagtttcagcttctgaagaagtacagtggctacttgagcagcctaaggcaagaattttccaagaaaaagaagaaaggaaagctgcctaaggaggccaggcagaagctgcttcactggtgggagctgcactacaagtggccttacccctcagagacggagaagattgcgcttgcggaatcgacaggactagatcagaagcagatcaacaactggttcatcaaccagaggaaacggcactggaagccatcggaggacatgccgttcgtcatgatggaaggttttcacccacagaatgctgctgcattgtacatggatggcccgttcatggcagatggaatgtaccgcctcggttcgtga</cdnaseq>

Protein Sequence

<aaseq>MDQSFGNLGGGGGAGGSGKAAASSFLQLPLSTAAAATAYYGTPL ALHQAAAAAGPSQYHGHGHPHHGGGHHHSKHGGAGGGEISAAEAESIKAKIMAHPQYS ALLAAYLDCQKVGAPPEVLERLTATAAKLDARPPGRHDARDPELDQFMEAYCNMLAKY REELTRPIDEAMEFLKRVESQLDTIAGGAHGGGAGSARLLLADGKSECVGSSEDDMDP SGRENEPPEIDPRAEDKELKFQLLKKYSGYLSSLRQEFSKKKKKGKLPKEARQKLLHW WELHYKWPYPSETEKIALAESTGLDQKQINNWFINQRKRHWKPSEDMPFVMMEGFHPQ NAAALYMDGPFMADGMYRLGS</aaseq>

Gene Sequence

<dnaseqindica>129..467#577..687#837..993#5090..5343#5486..5692#ctcccctccctctcgccattggagctagacagctcgagctccaggaggaagaagagagagagcctagctgctagggtttccatcggatttggttttttattttctttttgtttcttgtgtgtgttttgatggatcagagctttgggaatcttggaggaggaggaggagcaggggggagcggcaaggcggcggcgtcgtcgttcctgcagctgccgctgtccacggcggcggcggccaccgcgtactacggcacgccgctcgccttgcaccaggcggcggccgcggctggcccgtcgcagtaccacggtcacggtcacccccaccacggcggcggccaccaccacagcaagcacggcggcgccggtggtggggagatctcggcggcggaggccgagtccatcaaggccaagatcatggcgcacccccagtactccgccctcctcgcagcctacctcgactgccagaaagtatatacgctcgattaattcttctccgattttgttgaacaaaatactccgtagtaattatctatcgatcatatatatcactgcaattttgatccatccatccatccaggtcggagcgccgccggaggtgctggagaggctgaccgccacggcggcaaagctggacgcccgccctcccggccgccacgacgcgcgcgacccggagctcgaccagttcatggttcgttcgtccccccccaactccggcgaccagttcatatatcgttcatgatatattgacccgtccgtacgacgttgaatcgatcaatcaccgatgttggttgcattgatcgggttgattaatcggaatcgaatcaatcttcgacgcaggaggcgtactgcaacatgctggccaagtacagggaggagctgacgcggccgatcgacgaggccatggagttcctcaagagggtggagtcgcagctcgacaccatcgccggcggcgcccatggcggcggcgccggctcggcgcgcctcctcctcgccggtaaatcaaccaatcatccatccccctcctcctgctctcgcctgcggttttacttctatttacacacatgctccttctgcttcttctcttctgctgctgctgctgctgctgatgatgatgatctcgtcgtcggcggcgatggcggcggcggcggcggcggaggcttaccgcattaggaaatagtttgatccggataatggaggtggttgctttggatgattgccattgttagtatagctacccatccaaagccctgtggattagtaatttatttattggggttagtaacaagacgcctttgcagcagcatgcactaacaaaagtaattaaactaacaattagtagcggtctagtcgagtgattaatctaatcatgttggcaaccagggcactgtgagcaaccatgtctcaagcttctcctcctctcgtttcagcagcttcacctccattgtttattgcatccatccatccatccatggcagcagctagcacagcctagttgcaaaacacaacacatgctagcctttcaactcaaccatttcttttttcccctctttcttttggccatgaattgtctcttctctctttcttttcttactgctctactagatgacaagtgactagaagccttgtctttagggttccaaggcatgcagggcagaggagagaatcagcctgtctatagactaatagctagattgatggagattctgaatggtgattaagcccagtaaacaatggtttgaggaagagtattataactacatagagatgtatggcagtacaagcttggttaatcatctctctggttgctgctgattggatagcatgcatgcatctaccccggatcagtagtattattcttttcttgctctagtggaagtagagccatatgcattggaaattgttgtcatggggctagctaggtacccaatgttgcagcagcactgtacgaaccgtctttcttcttcgcacgtagcactgcagctgttcttgtaatggttttgggatgcagcacagattcatctgggcgttcgtgttttccggggggttgtactgtcgattgctgcagggcaggataatcaattaatatgatagagatctgatgaactgttgatagactactgttgaatgctttttattttctgtgcatatatatatgtatagaagtattggagaagagtgtctgattggtagatcaaactaggtcagttgcatttgattcatgatggaaattaagacagttgttggagcttgccagctgctactagtagttttcctttttttttcttgtgaaagattcaatttgattaagcagagatgcaactttattaggcaatattagtggaagtcccttaaatgaaaagttacagaaccatatattatcaaaggtttttatgaacaatatacaaatttattctatgatcattttttatattactaaatctatgttcgtcagatattgggaaagattcacccggcacttatgctgcaaatgtgaactcttctctattatctaaaacaaatgggagagattactagtttcttatctctgtgatgctcaaaacctcacatggtgattctgtattctctctatataagcctagcgcatctatgctgaattttcacaaataaatctcaactattgaaattaggccacttcaaaagatcttttgtcaatgagtttgctatatgttggtttacttctatgattgcttttttgataatgtatttcatctcatcctcgcgcatgcatgcccggttatttattgccagttatgtgttccatttgagatttaaagaaccagctaatatattattattgtttttcttgtttgttatggtatgacaactgtcctagcaaatccacatccacacatcgatctatatatcttaaccaatcagcaaggctctatttgtttgtatagatcagcatgttgtttatatcgcatcattggtattaaattgtaacagttgcctactatactggtgaaacttctgcctttaaaacaaatgacactagcttatacattaaacaaatatgattgtgcaaatgcatttactaattttttttatctaataaactgtgcttgtcacttgtcagtgtttaacaaactgtccatttttcagtcattcataagtgtcagtttccgcaccattagttttagtattatggtttcctactcttgccatgtatgcttaattagattcactttgctgaaacttggaaaattaccattaatgtgtccaaatccatggactggttttgattttataattttatcaaaactgtttgagaaatgtatttttcaaatgaattatcatgtttactcattccacaagttaattaacgtgtttctcctcaaaataagctaatgcgttttctataggcgccacaaataaaaagcaaagggttcattcacaaaattttgaaggttttttttagcaaataccaagtgccatgttattaaaagattaaaatcttgtcactgttaatgcattagtacatcaggaataattctttttctgcgtagaagcacaagggcaacattggtgtatttgtcatgccatttccttttttcatgttatttgtacctcatcttaaaaaaaaggagaaagtattacataggggactaatagcttatgtgaaagaccaccgactggtttataattaaacactggctcatttctttgaagctttttttttaaggatctggttttccctctagtagttctgagctgatgaaaagtttctatagcgggttactgagagaattacagtcattgtgctaccatgagaataaatacaataacagagtaacaaccatgagaatatgttcaagaactaatggattctaaaatttgaaaggcgcttaaaatgttttcttgacactattcatgatgagaattaaacggttaatcaagtaagacatgggacgataacaactactacctaatcctgtaaatctacagaatctccatgcttttcagttgctttttatgcacccacaatatagttttcagttgcatgttatcattggaggatgtagaatactcatgcatgcacaattttttataatatggggccacatatattatcttttattttcttgtatcacatcctgggtcagatcaacaactgtcactgtacagtttcctatgtatagatcaattattttgattgcccatctgaaattaagttatggtcatatgtatctttatttattttgaagttgatctccgaattattcaattacataggcccaagacaacgctttatgtgtgatatttttgtttctggttgtatggtagtaatttttgtttttttgcttttattttatccatttctttgttatatgctatattctgtaggacgcatggtcagcatgtgaccattctgtttagagcagagaaatgctctgtcaattctttatttctttccactaaatgattctttatctactgccataatatgtattcctttgaccattggaccaagttttttaggccaaagacctagcttttatataaagcaaaagaacataggtgataagagataggaccaagtttcagtcagtatcatttttttcgtcgaagcctgggactctacgtatacctagttcagtggtttctactatttggtttatcaaacactgttttaaaaccataatctgcacaccacaatctggtcaatatatctttcaactggctgatttggcacaaatcaaacctgacaaattaataaacctaaagcagtgctagttttatccttgtattgaatatccttgtcttttcacttgcatagttttttttaccgttttttatagtgttttcttctacgaaatcagtagggcaggatccttcttgaaatccatactctttactgtagctactctaccagtagtcaaatacacagtgtcaccctattcttgcattccaaaatggatagagttgtttacccacagctatgggcctttctgcgtctgttccattgctgaccaacatggtctagactgaagctcattccaacaatacaatagaaatctgatgaacaaaatgtagtatgatctcttacattaaccaccttttgtctgcagatggtaaatctgaatgtgttggttcttctgaggatgacatggacccaagtggccgcgaaaacgagccgcctgagatcgacccgcgcgctgaggataaggagctcaagtttcagcttctgaagaagtacagtggctacttgagcagcctaaggcaagaattttccaagaaaaagaagaaaggaaagctgcctaaggaggccaggcagaagctgcttcactggtgggagctgcactacaagtggccttacccctcagtaagattacacatacaaaattacctgataatatatagtaattgccacaattacctaatgcatacatagttctacaaacatcttagttcagatcagatgcatcatcacattgttactaactttgcaccaatgggatgagtaggagacggagaagattgcgcttgcggaatcgacaggactagatcagaagcagatcaacaactggttcatcaaccagaggaaacggcactggaagccatcggaggacatgccgttcgtcatgatggaaggttttcacccacagaatgctgctgcattgtacatggatggcccgttcatggcagatggaatgtaccgcctcggttcgtgaacctcgatctcgatcatcggcgtgtttgatgagagatccaatgccaagataaattgatcatggaatgtattcagcatgcgttgcaatgcatggacattgttatggaatttttggtttatttacctttcaccgtggattgacaaggtctcgatcatgttagtgttgatggcttatagttctccagtaatgttgttgtttttcctttcgatggcttgtaaaagtttaggtgtatcggaatttcgatcaacttgctcgtacgctggtaattaatttggtgatggtctatatgttgtatggttgtgcgtttcagattggtgttcaaagttgcctatctgaaacaattatatatatttatattgcttctcatttt</dnaseqindica>

External Link(s)

NCBI Gene:Os07g0129700, RefSeq:Os07g0129700