Difference between revisions of "Os03g0707600"
(→Labs working on this gene) |
(→References) |
||
| Line 18: | Line 18: | ||
==References== | ==References== | ||
| + | 1,Ogawa M, Kusano T, Katsumi M, et al. Rice gibberellin-insensitive gene homolog,< i> OsGAI</i>, encodes a nuclear-localized protein capable of gene activation at transcriptional level[J]. Gene, 2000, 245(1): 21-29. | ||
| + | 2,Ikeda A, Ueguchi-Tanaka M, Sonoda Y, et al. Slender rice mutant is caused by null mutation of the SLR gene, an ortholog of the height-regulating gene GAI/RGA/RHT/D8[C]//Advances in rice genetics, Los Baños, Laguna, Philippines, 22-27 October 2000. World Scientific Publishing Co. Pte. Ltd, 2003: 478-479. | ||
| + | 3,Itoh H, Ueguchi-Tanaka M, Sato Y, et al. The gibberellin signaling pathway is regulated by the appearance and disappearance of SLENDER RICE1 in nuclei[J]. The Plant Cell Online, 2002, 14(1): 57-70. | ||
| + | 4,Ikeda A, Sonoda Y, Vernieri P, et al. The slender rice mutant, with constitutively activated gibberellin signal transduction, has enhanced capacity for abscisic acid level[J]. Plant and cell physiology, 2002, 43(9): 974-979. | ||
| + | 5,Ueguchi-Tanaka M, Hirano K, Hasegawa Y, et al. Release of the repressive activity of rice DELLA protein SLR1 by gibberellin does not require SLR1 degradation in the gid2 mutant[J]. The Plant Cell Online, 2008, 20(9): 2437-2446. | ||
| + | 6,Asano K, Hirano K, Ueguchi-Tanaka M, et al. Isolation and characterization of dominant dwarf mutants, Slr1-d, in rice[J]. Molecular Genetics and Genomics, 2009, 281(2): 223-231. | ||
| + | 7,Hirano K, Asano K, Tsuji H, et al. Characterization of the molecular mechanism underlying gibberellin perception complex formation in rice[J]. The Plant Cell Online, 2010, 22(8): 2680-2696. | ||
| + | 8,Hayashi-Tsugane M, Maekawa M, Qian Q, et al. A rice mutant displaying a heterochronically elongated internode carries a 100 kb deletion[J]. Journal of Genetics and Genomics, 2011, 38(3): 123-128. | ||
| + | 9,Hirano K, Kouketu E, Katoh H, et al. The suppressive function of the rice DELLA protein SLR1 is dependent on its transcriptional activation activity[J]. The Plant Journal, 2012, 71(3): 443-453. | ||
==Structured Information== | ==Structured Information== | ||
Revision as of 16:52, 20 May 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
OsGAI, also known as slender rice 1(SLR1), is first identified as a homolog of the GAI gene of Arabidopsis (Ogawa, et al. 2000). It encodes a rice DELLA protein of 625 amino acids, which is characterized as a member of the GRAS family. Sequences analyses reveal that SLR1 contains a valine (polyS/T/V), a DELLA box, a TVHYNP region, a nuclear localization signal (NLS), a leucine heptad repeat (LZ) and the VHIID motif in N-terminal and the PFYRE motif and the SAW motif in C-terminal (Itoh 2002). In addition, function domain analyses reveal that the SLR1 protein can be divided into four parts: a regulatory domain for its repression activity, a dimer formation domain essential for signal perception and repression activity, and a repression domain at the C terminus, a GA signal perception domain located at the N terminus. Gibberellin (GA), a key phytohormone, controls many crucial aspects during the whole life cycle of plants, including germination, stem elongation, flower development and stress response. The study of mutant indicates that SLR1 is a negative regulator in GA signaling pathway, and overexpressing SLR1 gene in transgenic rice plants cause dwarf phenotype (Itoh 2002). DELLA protein SLR1 represses the GA-response gene expression by direct binding to transcription factor of target gene. Application of exogenous GA causes disappearance of SLR1-GFP in nuclei.
Expression
Genomic DNA blot analysis indicates the OsGAI is a single-copy gene in the rice genome. OsGAI transcripts increased within 6h upon GA3. The subcellular localization of OsGAI in vivo shows that OsGAI-GFP fusion protein locates in the nucleus concerned with a nuclear localization signal (NLS).
Evolution
The SLR1 protein shares a high overall identity with RHT-D1a in wheat (77.2%), D8 in maize (80.3%), and RGA and GAI in Arabidopsis (41.2 and 47.2%, respectively)
Labs working on this gene
- BioScience Center and Graduate School of Bioagricultural Sciences, Nagoya University, Chikusa-ku, Nagoya 464-8601, Japan
- Division of Biological Sciences, Graduate School of Science, Hokkaido University, Kita-ku N10-W8, Sapporo, 060-0810 Japan
- Bioscience and Biotechnology Center, Nagoya University, Nagoya 464-8601, Japan
- Nara Institute of Science and Technology, Nara 630-0101, Japan
- Graduate School of Nutritional and Environmental Sciences, University of Shizuoka, Shizuoka 422-8526, Japan
- Faculty of Agriculture, Kyushu University, Hakozaki 6-10-1, Higashi-ku, Fukuoka 812-8581, Japan
References
1,Ogawa M, Kusano T, Katsumi M, et al. Rice gibberellin-insensitive gene homolog,< i> OsGAI</i>, encodes a nuclear-localized protein capable of gene activation at transcriptional level[J]. Gene, 2000, 245(1): 21-29. 2,Ikeda A, Ueguchi-Tanaka M, Sonoda Y, et al. Slender rice mutant is caused by null mutation of the SLR gene, an ortholog of the height-regulating gene GAI/RGA/RHT/D8[C]//Advances in rice genetics, Los Baños, Laguna, Philippines, 22-27 October 2000. World Scientific Publishing Co. Pte. Ltd, 2003: 478-479. 3,Itoh H, Ueguchi-Tanaka M, Sato Y, et al. The gibberellin signaling pathway is regulated by the appearance and disappearance of SLENDER RICE1 in nuclei[J]. The Plant Cell Online, 2002, 14(1): 57-70. 4,Ikeda A, Sonoda Y, Vernieri P, et al. The slender rice mutant, with constitutively activated gibberellin signal transduction, has enhanced capacity for abscisic acid level[J]. Plant and cell physiology, 2002, 43(9): 974-979. 5,Ueguchi-Tanaka M, Hirano K, Hasegawa Y, et al. Release of the repressive activity of rice DELLA protein SLR1 by gibberellin does not require SLR1 degradation in the gid2 mutant[J]. The Plant Cell Online, 2008, 20(9): 2437-2446. 6,Asano K, Hirano K, Ueguchi-Tanaka M, et al. Isolation and characterization of dominant dwarf mutants, Slr1-d, in rice[J]. Molecular Genetics and Genomics, 2009, 281(2): 223-231. 7,Hirano K, Asano K, Tsuji H, et al. Characterization of the molecular mechanism underlying gibberellin perception complex formation in rice[J]. The Plant Cell Online, 2010, 22(8): 2680-2696. 8,Hayashi-Tsugane M, Maekawa M, Qian Q, et al. A rice mutant displaying a heterochronically elongated internode carries a 100 kb deletion[J]. Journal of Genetics and Genomics, 2011, 38(3): 123-128. 9,Hirano K, Kouketu E, Katoh H, et al. The suppressive function of the rice DELLA protein SLR1 is dependent on its transcriptional activation activity[J]. The Plant Journal, 2012, 71(3): 443-453.
Structured Information
| Gene Name |
Os03g0707600 |
|---|---|
| Description |
OsGAI |
| Version |
NM_001057567.1 GI:115454862 GeneID:4333860 |
| Length |
2496 bp |
| Definition |
Oryza sativa Japonica Group Os03g0707600, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 3:29273085..29275580 |
| Sequence Coding Region |
29273300..29275177 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008396:29273085..29275580 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008396:29273085..29275580 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgaagcgcgagtaccaagaagccggcgggagcagcggcggcgggagcagcgccgatatggggtcgtgcaaggacaaggtgatggcgggggcggcgggggaggaggaggacgtcgacgagctgctggcggcgctcgggtacaaggtgcggtcgtccgacatggccgacgtcgcgcagaagctggagcagctggagatggccatggggatgggcggcgtgagcgcccccggcgccgcggatgacgggttcgtgtcgcacctggccacggacaccgtgcactacaacccctcggacctctcctcctgggtcgagagcatgctttccgagctcaacgcgccgctgccccctatcccgccagcgccgccggctgcccgccatgcttccacctcgtccactgtcaccggcggcggtggtagcggcttctttgaactcccagccgctgccgactcgtcgagtagcacctacgccctcaggccgatctccttaccggtggtggcgacggctgacccgtcggctgctgactcggcgagggacaccaagcggatgcgcactggcggcggcagcacgtcgtcgtcctcatcgtcgtcttcctctctgggcggtggggcctcgcggggctctgtggtggaggctgctccgccggcgacgcaaggggccgcggcggcgaatgcgcccgccgtgccggttgtggtggttgacacgcaggaggctgggatccggctggtgcacgcgttgctggcgtgcgcggaggccgtgcagcaggagaacttcgcggccgcggaggcgctggtcaagcagatccccacgctggccgcgtcccagggcggcgccatgcgcaaggtcgctgcctacttcggcgaggccctcgcccgccgcgtgtaccgcttccgccccgcggacagcaccctcctcgacgccgccttcgccgaccttctgcacgcccacttctacgagtcctgcccctacctcaagttcgcccacttcaccgcaaatcaagccatcctcgaggctttcgccggctgccaccgcgtccacgtcgtcgacttcggcatcaagcaggggatgcaatggccagctctcctccaggccctcgcccttcgtcccggcggccccccatcgttccgcctcaccggcgtcggccccccgcagccggacgagaccgacgccttgcagcaggtgggttggaagcttgcccagttcgcgcacaccattcgcgtcgacttccagtaccggggactcgtcgccgccactctcgcggacttggagccgttcatgctgcagccggagggcgaggcggacgcgaacgaggagcctgaggtgatcgccgtcaactcggtgttcgagctgcaccggctgctcgcgcagcccggcgcgctggagaaggtcctgggcacggtgcacgcggtgcggccaaggatcgtcaccgtggtagagcaggaggccaaccacaactccggctcattcctcgaccggttcaccgagtcgctgcactactactccaccatgttcgattccctcgagggcggcagctccggccaggccgagctctctccgccggctgccgggggcggcggtggcacggaccaggtcatgtccgaggtgtacctcggccggcagatctgcaacgtcgtggcgtgcgagggcgcggagcgcacggagcgccacgagacgctggggcagtggcgcaaccgcctcggccgcgccggcttcgagcccgtgcacctgggctccaatgcctacaaacaggcgagcacgctcctcgcgcttttcgccggcggcgacggctaccgggtggaggagaaggagggctgcctcacgctgggctggcacacgcgcccgctcatcgccacctcggcatggcgcgtcgccgcggcgtga</cdnaseq> |
| Protein Sequence |
<aaseq>MKREYQEAGGSSGGGSSADMGSCKDKVMAGAAGEEEDVDELLAA LGYKVRSSDMADVAQKLEQLEMAMGMGGVSAPGAADDGFVSHLATDTVHYNPSDLSSW VESMLSELNAPLPPIPPAPPAARHASTSSTVTGGGGSGFFELPAAADSSSSTYALRPI SLPVVATADPSAADSARDTKRMRTGGGSTSSSSSSSSSLGGGASRGSVVEAAPPATQG AAAANAPAVPVVVVDTQEAGIRLVHALLACAEAVQQENFAAAEALVKQIPTLAASQGG AMRKVAAYFGEALARRVYRFRPADSTLLDAAFADLLHAHFYESCPYLKFAHFTANQAI LEAFAGCHRVHVVDFGIKQGMQWPALLQALALRPGGPPSFRLTGVGPPQPDETDALQQ VGWKLAQFAHTIRVDFQYRGLVAATLADLEPFMLQPEGEADANEEPEVIAVNSVFELH RLLAQPGALEKVLGTVHAVRPRIVTVVEQEANHNSGSFLDRFTESLHYYSTMFDSLEG GSSGQAELSPPAAGGGGGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLG RAGFEPVHLGSNAYKQASTLLALFAGGDGYRVEEKEGCLTLGWHTRPLIATSAWRVAA A</aaseq> |
| Gene Sequence |
<dnaseqindica>216..2093#actagttgcttgcctcttcccacctcacctcgcattgcaatctcgcatcgcctcttccttctcttcttccccttcttctccccttctcatccaacctcgcttcccaaccctggatccaaatcccaacctatcccaaagccgaaaccgaggagaggaaaaaggttacgcgcaattattactagctatagctaggtaggtttgggggaggcgagatcatgaagcgcgagtaccaagaagccggcgggagcagcggcggcgggagcagcgccgatatggggtcgtgcaaggacaaggtgatggcgggggcggcgggggaggaggaggacgtcgacgagctgctggcggcgctcgggtacaaggtgcggtcgtccgacatggccgacgtcgcgcagaagctggagcagctggagatggccatggggatgggcggcgtgagcgcccccggcgccgcggatgacgggttcgtgtcgcacctggccacggacaccgtgcactacaacccctcggacctctcctcctgggtcgagagcatgctttccgagctcaacgcgccgctgccccctatcccgccagcgccgccggctgcccgccatgcttccacctcgtccactgtcaccggcggcggtggtagcggcttctttgaactcccagccgctgccgactcgtcgagtagcacctacgccctcaggccgatctccttaccggtggtggcgacggctgacccgtcggctgctgactcggcgagggacaccaagcggatgcgcactggcggcggcagcacgtcgtcgtcctcatcgtcgtcttcctctctgggcggtggggcctcgcggggctctgtggtggaggctgctccgccggcgacgcaaggggccgcggcggcgaatgcgcccgccgtgccggttgtggtggttgacacgcaggaggctgggatccggctggtgcacgcgttgctggcgtgcgcggaggccgtgcagcaggagaacttcgcggccgcggaggcgctggtcaagcagatccccacgctggccgcgtcccagggcggcgccatgcgcaaggtcgctgcctacttcggcgaggccctcgcccgccgcgtgtaccgcttccgccccgcggacagcaccctcctcgacgccgccttcgccgaccttctgcacgcccacttctacgagtcctgcccctacctcaagttcgcccacttcaccgcaaatcaagccatcctcgaggctttcgccggctgccaccgcgtccacgtcgtcgacttcggcatcaagcaggggatgcaatggccagctctcctccaggccctcgcccttcgtcccggcggccccccatcgttccgcctcaccggcgtcggccccccgcagccggacgagaccgacgccttgcagcaggtgggttggaagcttgcccagttcgcgcacaccattcgcgtcgacttccagtaccggggactcgtcgccgccactctcgcggacttggagccgttcatgctgcagccggagggcgaggcggacgcgaacgaggagcctgaggtgatcgccgtcaactcggtgttcgagctgcaccggctgctcgcgcagcccggcgcgctggagaaggtcctgggcacggtgcacgcggtgcggccaaggatcgtcaccgtggtagagcaggaggccaaccacaactccggctcattcctcgaccggttcaccgagtcgctgcactactactccaccatgttcgattccctcgagggcggcagctccggccaggccgagctctctccgccggctgccgggggcggcggtggcacggaccaggtcatgtccgaggtgtacctcggccggcagatctgcaacgtcgtggcgtgcgagggcgcggagcgcacggagcgccacgagacgctggggcagtggcgcaaccgcctcggccgcgccggcttcgagcccgtgcacctgggctccaatgcctacaaacaggcgagcacgctcctcgcgcttttcgccggcggcgacggctaccgggtggaggagaaggagggctgcctcacgctgggctggcacacgcgcccgctcatcgccacctcggcatggcgcgtcgccgcggcgtgatcgcaaagtttttgggacgctgcaccacgtgtttgccgccgatcacggcgcgacccccccccccccccctctctctctccccggctcaccggcggcacaattgaagcttgacgtcaacgaacgctcaattgcagcgaccgatcgggcttacggttctcgccggcgtgaagagatcgacgactggactccgaccagaccgacggcttgttcgttctcctttcccaattaccccgttccttggtcctcctagcccatctattatgtttaaatgtcaattattatgtgtaatttctccaatcgctcatattaaataaggacgaaccgaactggatttcattagctccaatgagaattttgtatacaaggcaccgatctaaaaattgagctatatgttcatgagtta</dnaseqindica> |
| External Link(s) |