Difference between revisions of "Os11g0126900"

From RiceWiki
Jump to: navigation, search
(Evolution)
(Evolution)
Line 14: Line 14:
  
 
===Evolution===
 
===Evolution===
According to the phylogenic analysis of the amino acid sequences of 18 OsNAC proteins, OsNAC10 is in the subgroup Ⅰ.
+
According to the phylogenic analysis of the amino acid sequences of 18 OsNAC proteins, OsNAC10 is in the subgroup Ⅰ.[[File:os.jpg|right|thumb|500px|'''Figure 3.''' ''Expression analyses of OsMADS29(from reference <ref name="ref1"/>).'']]
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.

Revision as of 08:34, 21 May 2014

Please input one-sentence summary here.

The rice Os11g0126900 was reported as NAC (an acronym for NAM [No Apical Meristem], ATAF1-2, and CUC2 [Cup-Shaped Cotyledon]) domain gene, OsNAC10,in 2010 by Korean researchers.

Annotated Information

Function

OsNAC10 plays important role in enhancing stress tolerance when overexpressed in rice.

Expression

  • OsNAC10 is expressed predominantly in roots and panicles[1] (finger 1 A).
    Figure 1.Expression analyses of OsNAC10(from reference [1]).
  • The expression of OsNAC10 is induced by drought, high salinity, and ABA but not by low temperature[1].(finger 1 B)
  • 34 root-specific and 40 leaf-specific target genes were up-regulated when OsNAC10 was overexpressed in transgenic plants.Transcript levels of seven root-specific target genes [P450, Zn-finger, HAK5, 2OG-Fe(Ⅱ),NCED, NAC, and KUP3] were increased in transgenic roots. Expression of two leaf-specific target genes, LRR and Peroxidase, was found to be OsNAC10 dependent only in GOS2:OsNAC10 leaves but not in RCc3:OsNAC10 leaves. Expression of two common target genes, F-box and Muts4, was found to be OsNAC10 dependent both in roots and leaves of the GOS2:OsNAC10 plants[1].(finger 2)
    Figure 2.

Evolution

According to the phylogenic analysis of the amino acid sequences of 18 OsNAC proteins, OsNAC10 is in the subgroup Ⅰ.
Figure 3. Expression analyses of OsMADS29(from reference [1]).

You can also add sub-section(s) at will.

Labs working on this gene

  • School of Biotechnology and Environmental Engineering, Myongji University, Yongin 449-728, Korea.
  • National Academy of Agricultural Science, Suwon 441–707, Korea.
  • School of Agricultural Biotechnology, Seoul National University, Seoul 151–921, Korea.
  • CropDesign NV, B–9052 Ghent, Belgium

References

<references> [1]

Structured Information

Gene Name

Os11g0126900

Description

Similar to NAC domain transcription factor

Version

NM_001072159.1 GI:115483930 GeneID:4349648

Length

2046 bp

Definition

Oryza sativa Japonica Group Os11g0126900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 11

Location

Chromosome 11:1215803..1217848

Sequence Coding Region

1216006..1216177,1216305..1216612,1216879..1216914

Expression

GEO Profiles:Os11g0126900

Genome Context

<gbrowseImage1> name=NC_008404:1215803..1217848 source=RiceChromosome11 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008404:1215803..1217848 source=RiceChromosome11 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgccgagcagcggcggcgccatgcctgcccttccaccaggcttccgcttccaccccaccgacgaggagctcatcgttcactacctcatgaaccaggccgcctccgtcaagtgccccgtgccaatcatcgccgaggtcaacatctacaagtgcaacccatgggaccttcctggtaaggctttgttcggcgagaacgaatggtacttcttcagcccgagggaccgcaagtaccccaacggcgctcgccccaaccgcgccgccggctcggggtactggaaggccaccggcaccgacaagtccatcctctccactccgaccagcgacaacatcggcgtcaagaaggccctcgtcttctacaagggcaagcctcccaagggcgtcaagaccgactggatcatgcacgagtaccgtctcaccggcacatcagctaacagcaccaccaccacaaagcagcgtagagcgtcatccatgaccatgaggaatccacaagaagagcaacgacttcaattcctctga</cdnaseq>

Protein Sequence

<aaseq>MPSSGGAMPALPPGFRFHPTDEELIVHYLMNQAASVKCPVPIIA EVNIYKCNPWDLPGKALFGENEWYFFSPRDRKYPNGARPNRAAGSGYWKATGTDKSIL STPTSDNIGVKKALVFYKGKPPKGVKTDWIMHEYRLTGTSANSTTTTKQRRASSMTMR NPQEEQRLQFL</aaseq>

Gene Sequence

<dnaseqindica>204..375#503..810#1077..1112#atttcaatccttcctcttccttagcttattagcttccttccttcactagtgccagttttcctcctacctaatctaagctagccaggtcgtcatcttcttccttcagctcacgctgaccaaacaccatctgttattctgtttgtttgtttttttaaaaaaaagaaaaaaaatctagctaggcgagccgattgaaggagctgagcatgccgagcagcggcggcgccatgcctgcccttccaccaggcttccgcttccaccccaccgacgaggagctcatcgttcactacctcatgaaccaggccgcctccgtcaagtgccccgtgccaatcatcgccgaggtcaacatctacaagtgcaacccatgggaccttcctggtaactaactaactaatcaccatacatatatatactatccatgtatcaattaaactcgatcaaattaatgccttcaaactgaccaaatttaactttgggctttgaaaatggatatgggatgttgcaggtaaggctttgttcggcgagaacgaatggtacttcttcagcccgagggaccgcaagtaccccaacggcgctcgccccaaccgcgccgccggctcggggtactggaaggccaccggcaccgacaagtccatcctctccactccgaccagcgacaacatcggcgtcaagaaggccctcgtcttctacaagggcaagcctcccaagggcgtcaagaccgactggatcatgcacgagtaccgtctcaccggcacatcagctaacagcaccaccaccacaaagcagcgtagagcgtcatccatgaccatgagggtgagattaattacttaactaatttagttttctcttcgtcgtacgtcttgtttgaaagctacttgttgtttggcataaagaaggagcaacgtgcatgttgctcttagttaactcagtacaaagtcaaatgagttgatgttgattgagcttgttttattcttggtatatattttattttttagaaaagggttaaagtttgcacgcttctaattattgtttactgcatttgtgattgtccatcagctggacgactgggtgctgtgcagaatccacaagaagagcaacgacttcaattcctctgaccaacacgaccaagaacccgaggaatcaaccgtcgaacagcttgaagacatccatgacaacaactcctctgaacaacctccagctccagctgacatgaacaaccaacagtcagatttccagcccatgacggcgatgagcatgagcaagtcatgctccctcaccgatctcctcaacaccatcgactgcgccgcgctctcgcagtttctcctcgacggctcatccgacgccatcgctgagcctcctgctcctcccagccccctaatatacacaacacctcatccaaattaccaaacactaaactataacattaacagcaacagcagcatgccacacgccttcgagtcacgcctagatcatcacgatggttacgttaacaattataatgttaatggcctgaggaggaagagaatgatggcgtgtagtgcaacttcctttgatgatggcagcagcagcaatgactttgtgcatgccgttgtcaagaaaccgcagctgctgccaagtgattcgaggggtagtggttttggaggaggttactgcaaccagcagctttcagagactgcgactggctttcagtttcagaacggcaatctgctgagccatccatttcctctgaacaatcatctgcagatgcagtagtaggcgtctagatcccgtttaccgatcgatctgaagagaggtgaattaatttcaacgaatgaaactacagattcagagaggaagatactgattgttccatttgtgatttattttgaggagttgcatgggcagatagacaaacagacggaattcttgatgtaaccgatgcaaggaaagattcagatttcttcctatggcattaatttgtgagtttttttttgttttcattttcatgtacaagaatgtaaattataaatggtaatatcgtgcaagctagtactcaagccaatttatatg</dnaseqindica>

External Link(s)

NCBI Gene:Os11g0126900, RefSeq:Os11g0126900

  1. 1.0 1.1 1.2 1.3 1.4 1.5 Jeong, J. S., Kim, Y. S.,Baek, K. H.,et al. (2010). "Root-specific expression of OsNAC10 improves drought tolerance and grain yield in rice under field drought conditions." Plant Physiol 153(1): 185-197.