Difference between revisions of "Os06g0286700"
(→References) |
(→Evolution) |
||
| Line 22: | Line 22: | ||
[[File:Genome organization of the Pi29 locus in four wild species.png]]<ref name="ref5" /> | [[File:Genome organization of the Pi29 locus in four wild species.png]]<ref name="ref5" /> | ||
| − | The Pi2/9 gene family members are indicated by the arrows with the transcriptional direction. The family members within a same vertical group (VG) are indicated with the same color. The VG4 in which the three cloned resistance genes (Pi2, Pi9 and Piz-t) are located is highlighted by dashed lines in brown between diVerent species. The non-Pi2/9 homologues are indicated with rectangles. NIP nitrate-induced protein gene, PK protein kinase gene, UDP-T UDP-glycosyltrans-ferase-like protein, UTP UTP-glycosyltransferase-like protein. '''a''' The Pi2/9 locus in the cultivated rice line Nipponbare. Nbs3-OS-NPB was indicated in a Wlled gray arrow, which shows a signiWcant diVerence with other NBS-LRR genes as discussed previously <ref name="ref6" />, '''b''' The Pi2/9 locus in O. nivara, '''c''' The Pi2/9 locus in O. punctata, '''d''' the Pi2/9 locus in the BB subgenome of O. minuta, '''e''' The Pi2/9 locus in the CC subgenome of O. minuta, '''f''' the Pi2/9 locus in O. oYcinalis. The Wgure was drawn with the BioEdit program | + | The Pi2/9 gene family members are indicated by the arrows with the transcriptional direction. The family members within a same vertical group (VG) are indicated with the same color. The VG4 in which the three cloned resistance genes (Pi2, Pi9 and Piz-t) are located is highlighted by dashed lines in brown between diVerent species. The non-Pi2/9 homologues are indicated with rectangles. NIP nitrate-induced protein gene, PK protein kinase gene, UDP-T UDP-glycosyltrans-ferase-like protein, UTP UTP-glycosyltransferase-like protein. '''a''' The Pi2/9 locus in the cultivated rice line Nipponbare. Nbs3-OS-NPB was indicated in a Wlled gray arrow, which shows a signiWcant diVerence with other NBS-LRR genes as discussed previously <ref name="ref6" />, '''b''' The Pi2/9 locus in O. nivara, '''c''' The Pi2/9 locus in O. punctata, '''d''' the Pi2/9 locus in the BB subgenome of O. minuta, '''e''' The Pi2/9 locus in the CC subgenome of O. minuta, '''f''' the Pi2/9 locus in O. oYcinalis. The Wgure was drawn with the BioEdit program <ref name="ref7" />. |
== Nucleotide Polymorphism of the Pi9 Alleles == | == Nucleotide Polymorphism of the Pi9 Alleles == | ||
Revision as of 02:48, 23 May 2014
This is a broad-spectrum resistance(R) gene to rice blast
Contents
Annotated Information
尼松伟
Function
Blast is a very common disease found in rice. Blast causes immense damage to rice in rice-growing countries .And Pi9 alleles are mainly responsible for resistance to rice blast. We can use Pi1 and pi2 to improve the resistance ability to blast through hybridization.
The rice disease blast, caused by the fungus Magnaporthe oryzae, is one of the most devastating diseases afflicting the rice crop [1]and is best combated by the deployment of genetic resistance [2].
Expression
editing We test the relationship between Pi1,Pi2 and D12 gene in expression. When Pi1,Pi2 and D12 gene unit together, they will improve the resistance to blast by a great deal in the field condition.Pi9 gene lies on the chromosome6.
Evolution
The number of Pi2/9 family members in the four wild species ranges from two copies to 12 copies. Although these genes are conserved in structure and categorized into the same subfamily, sequence duplications and subsequent inversions or uneven crossing overs were observed, suggesting that the locus in diVerent wild species has undergone dynamic changes. [3]
To evaluate the phylogenetic relationship among the Pi9 alleles, we constructed neighbor-joining trees using the full-length fragment, the NBS region, and the LRR region. The analysis indicated that all these alleles are clustered into the same clade and belong to the same NBS-LRR sub-family. Two obvious haplotypes are distinguishable in the phylogenetic tree. Group I is mainly composed of the Asian cultivated rice O. sativa and its two ancestors, O. nivara, and O. rufipogon. Most of the African cultivated rice O. glaberrima and its ancestor O. barthii are clustered in group II. These results suggest that different selection pressures have occurred in the two unique groups of the Oryza species during domestication and/or natural selection.[4]
The Pi2/9 gene family members are indicated by the arrows with the transcriptional direction. The family members within a same vertical group (VG) are indicated with the same color. The VG4 in which the three cloned resistance genes (Pi2, Pi9 and Piz-t) are located is highlighted by dashed lines in brown between diVerent species. The non-Pi2/9 homologues are indicated with rectangles. NIP nitrate-induced protein gene, PK protein kinase gene, UDP-T UDP-glycosyltrans-ferase-like protein, UTP UTP-glycosyltransferase-like protein. a The Pi2/9 locus in the cultivated rice line Nipponbare. Nbs3-OS-NPB was indicated in a Wlled gray arrow, which shows a signiWcant diVerence with other NBS-LRR genes as discussed previously [5], b The Pi2/9 locus in O. nivara, c The Pi2/9 locus in O. punctata, d the Pi2/9 locus in the BB subgenome of O. minuta, e The Pi2/9 locus in the CC subgenome of O. minuta, f the Pi2/9 locus in O. oYcinalis. The Wgure was drawn with the BioEdit program [6].
Nucleotide Polymorphism of the Pi9 Alleles
Of 2,927 nucleotides, 435 polymorphic sites including alignment gaps (∼18.9%) were detected among the 40 sequences using the DnaSP program. An intermediate-diversified nucleotide diversity (π=0.03348, P=0.000293) for the Pi9 alleles was observed based on the previously published criteria [7]. The average nucleotide diversity of the LRR region (π=0.04554, P=0.00354; θ=0.04307, P=0.01263) is much higher than that of the NBS region (π=0.02098, P=0.00194; θ=0.02746, P=0.00816). Both values are similar in cultivated rice and wild rice groups. These results suggest that the LRR domain is important in the variation of the Pi9 alleles.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here. 1.National Key Laboratory of Crop Genetic Improvement, 2.National Center of Plant Gene Research and National 3.Center of Crop Molecular Breeding, Huazhong 4.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 5.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 6. 2Guangxi Key Laboratory of Subtropical Bioresource Conversation and Utilization,Nanning
References
Please input cited references here. 1.H. L. Chen, B. T. Chen, D. P. Zhang, Y. F. Xie, and Qifa Zhang, 2001, Pathotypes of Pyricularia grisea in Rice Fields of Central and Southern China, Plant Disease 85:843-850. 2 J. Liu : Y. Hu: Y. Ning : N. Jiang : J. Wu : Y. Xiao : X. Liu, L. Dai : G.-L. Wang2011, Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species, J. Plant Biol. (2011) 54:294–302 3. H. Jiang ,Y. Feng , L. Bao ,X. Li, G. Gao, Q. Zhang , J. Xiao , C. Xu _ Y. He,2012, Improving blast resistance of Jin 23B and its hybrid rice by marker-assisted gene pyramiding, Mol Breeding (2012) 30:1679–1688 4. Zhao P,Feng R.R,Xiao Q Zh,Yang P.Zh,Lin. W,Liu P.Q,Li.RB,2013,Pyramiding brown planthopper genes, bph20(t)and bph21(t),and rice blast resistant gene Pi9 in rice (Oryza sativa L.), Journal of Southen Agricalture,44(6):885-892
<references>
Structured Information
| Gene Name |
Os06g0286700 |
|---|---|
| Description |
Similar to NBS-LRR disease resistance protein homologue |
| Version |
NM_001063943.1 GI:115467617 GeneID:4340778 |
| Length |
2957 bp |
| Definition |
Oryza sativa Japonica Group Os06g0286700, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 6:10386510..10389466 |
| Sequence Coding Region |
10386510..10386566,10386662..10389466 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008399:10386510..10389466 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008399:10386510..10389466 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</cdnaseq> |
| Protein Sequence |
<aaseq>MQAFLRAAEVMKKKDELLKLVKLRERHRIAIRIHNLKSRVEEVS SRNTRYNLVEPISSGTEDDMDSYAEDIRNQSARNVDEAELVGFSDSKKRLLEMIDTNA NDGPAKVICVVGMGGLGKTALSRKIFESEEDIRKNFPCNAWITVSQSFHRIELLKDMI RQLLGPSSLDQLLQELQGKVVVQVHHLSEYLIEELKEKRYFVVLDDLWILHDWNWINE IAFPKNNKKGSRIVITTRNVDLAEKCATASLVYHLDFLQMNDAITLLLRKTNKNHEDM ESNKNMQKMVERIVNKCGRLPLAILTIGAVLATKQVSEWEKFYEHLPSELEINPSLEA LRRMVTLGYNHLPSHLKPCFLYLSIFPEDFEIKRNRLVGRWIAEGFVRPKVGMTTKDV GESYFNELINRSMIQRSRVGIAGKIKTCRIHDIIRDITVSISRQENFVLLPMGDGSDL VQENTRHIAFHGSMSCKTGLDWSIIRSLAIFGDRPKSLAHAVCPDQLRMLRVLDLEDV TFLITQKDFDHIALLCHLKYLSIGYSSSIYSLPRSIGKLQGLQTLNMPSTYIAALPSE ISKLQCLHTLRCIGQFHYDNFSLNHPMKCITNTICLPKVFTPLVSRDDRAKQIAELHM ATKSCWSESFGVKVPKGIGKLRDLQVLEYVDIRRTSSRAIKELGQLSKLRKLGVTTNG STKEKCKILYAAIEKLSSLQSLHVDAVLFSGIIGTLECLDSISSPPPLLRTLRLNGSL EEMPNWIEQLTHLKKFDLRRSKLKEGKTMLILGALPNLMVLYLYRNAYLGEKLVFKTG AFPNLRTLCIYELDQLREIRFEDGSSPLLEKIEIGKCRLESGIIGIIHLPKLKEIPIT YGSKVAGLGQLEGEVNTHPNRPVLLMYSDRRYHDLGAEAEGSSIEVQTADPVPDAEGS VTVAVEATDPLPEQEGESSQSQVITLTTNDRSVTPYMAA</aaseq> |
| Gene Sequence |
<dnaseqindica>1..57#153..2957#atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaaggtttgggcagagcaaatacgtgacctgtcgtatgacattgaagattccctgatgaatttaaagtccatattgaaagccaaaccctatttcgtcagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</dnaseqindica> |
| External Link(s) |
- ↑ 1.0 1.1 Ou SH (1985) Rice Disease, 2nd edn. Commonwealth MycologicalInstitute, Kew Surrey, pp 109–201
- ↑ 2.0 2.1 Bonman J, Khush G, Nelson R (1992) Breeding rice for resistance to pests. Annu Rev Phytopathol 30:507–528
- ↑ 3.0 3.1 3.2 Liangying D, Jun W, Xunbo L, Xuejun W, Xionglun L, Chatchawan J, Dave K, Yeisoo Y, Rod A. W, Bin H, Bo Z, Guo-Liang W. Genomic structure and evolution of the Pi2/9 locus in wild rice species, Theoretical and Applied Genetics, 2010, 121(2): 295-309
- ↑ 4.0 4.1 4.2 4.3 J. Liu : Y. Hu: Y. Ning : N. Jiang : J. Wu : Y. Xiao : X. Liu, L. Dai : G.-L. Wang2011, Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species, J. Plant Biol. (2011) 54:294–302
- ↑ 5.0 5.1 Zhou B, Dolan M, Sakai H, Wang GL (2007) The genomic dynamics and evolutionary mechanism of the Pi2/9 locus in rice. Mol Plant Microbe Interact 20:63–71
- ↑ 6.0 6.1 Hall TA (1999) BioEdit: a user-friendly biological sequence alignment editor and analysis program for Windows 95/98/NT. Nucl Acids Symp Series 41:95–98
- ↑ 7.0 7.1 Yang S, Gu T, Pan C, Feng Z, Ding J, Hang Y, Chen J, Tian D (2008) Genetic variation of NBS-LRR class resistance genes in rice lines. Theor Appl Genet 16:165–177


