Difference between revisions of "Os02g0244100"

From RiceWiki
Jump to: navigation, search
(References)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
[[File:1.png|right|thumb|250px| ''grain phenotype and structure of ''GW2'' (from reference<ref name="ref1" />).'']]
 
This gene is reported as GW2, a new QTL that controls rice grain width and weight. GW2 encodes a previously unknown RING-type protein with E3 ubiquitin ligase activity, which is known to function in the degradation by the ubiquitin-proteasome pathway. Loss of GW2 function increased cell numbers, resulting in a larger (wider) spikelet hull, and it accelerated the grain milk filling rate, resulting in enhanced grain width, weight and yield. GW2 negatively regulates cell division by targeting its substrate(s) to proteasomes for regulated proteolysis. The functional characterization of GW2 provides insight into the mechanism of seed development and is a potential tool for improving grain yield in crops.
 
This gene is reported as GW2, a new QTL that controls rice grain width and weight. GW2 encodes a previously unknown RING-type protein with E3 ubiquitin ligase activity, which is known to function in the degradation by the ubiquitin-proteasome pathway. Loss of GW2 function increased cell numbers, resulting in a larger (wider) spikelet hull, and it accelerated the grain milk filling rate, resulting in enhanced grain width, weight and yield. GW2 negatively regulates cell division by targeting its substrate(s) to proteasomes for regulated proteolysis. The functional characterization of GW2 provides insight into the mechanism of seed development and is a potential tool for improving grain yield in crops.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
[[File:无标题.png|left|thumb|250px| ''Cellular properties and expression pattern of GW2. (from reference<ref name="ref1" />).'']]
 +
Transient expression in onion
 +
epidermal cells showed that GFP-GW2 localized to the cytoplasm.RT-PCR data in both FAZ1 and
 +
NIL(GW2) showed that GW2 mRNA was expressed constitutively in
 +
shoots and roots of seedlings, inflorescent meristems, young flowers,
 +
leaves and spikelet hulls and endosperms 4 d after fertilization.The GW2 promoter–GFP expression analysis
 +
showed that GFP was strongly expressed in roots
 +
, leaves, and floral organs including stamens, pistils and hulls.
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
[[File:1471-2229-10-143-1.jpg|right|thumb|350px| ''A.Relationship of ZmGW2-CHR4 and ZmGW2-CHR5. B.Phylogenetic tree of GW2 protein sequences in maize, rice, sorghum and barley. (from reference<ref name="ref2" />).'']]
 +
The rice GW2 gene has two co-orthologs located on duplicated chromosomes in maize. Both genes consist of eight exons, with an overall sequence similarity of 94% to each other and 93% to the rice GW2 gene across the coding region. They were named ZmGW2-CHR4 and ZmGW2-CHR5.
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
Line 18: Line 26:
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
Xian-Jun Song, Wei Huang, Min Shi, Mei-Zhen Zhu, Hong-Xuan Lin. A QTL for rice grain width and weight encodes a previously unknown RING-type E3 ubiquitin ligase Nature Genetics, 2007, 39: 623-630.
+
<ref name="ref1">
 +
Song, X. J., Huang, W., Shi, M., Zhu, M. Z., & Lin, H. X. (2007). A QTL for rice grain width and weight encodes a previously unknown RING-type E3 ubiquitin ligase. Nature genetics, 39(5), 623-630.</ref>
 +
<ref name="ref2">
 +
Li, Q., Li, L., Yang, X., Warburton, M.L., Bai, G., Dai, J., Li, J., and Yan, J. (2010). Relationship, evolutionary fate and function of two maize co-orthologs of rice GW2 associated with kernel size and weight. BMC Plant Biol 10, 143.</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==

Revision as of 05:40, 23 May 2014

Please input one-sentence summary here.

Annotated Information

Function

grain phenotype and structure of GW2 (from reference[1]).

This gene is reported as GW2, a new QTL that controls rice grain width and weight. GW2 encodes a previously unknown RING-type protein with E3 ubiquitin ligase activity, which is known to function in the degradation by the ubiquitin-proteasome pathway. Loss of GW2 function increased cell numbers, resulting in a larger (wider) spikelet hull, and it accelerated the grain milk filling rate, resulting in enhanced grain width, weight and yield. GW2 negatively regulates cell division by targeting its substrate(s) to proteasomes for regulated proteolysis. The functional characterization of GW2 provides insight into the mechanism of seed development and is a potential tool for improving grain yield in crops.

Expression

Cellular properties and expression pattern of GW2. (from reference[1]).

Transient expression in onion epidermal cells showed that GFP-GW2 localized to the cytoplasm.RT-PCR data in both FAZ1 and NIL(GW2) showed that GW2 mRNA was expressed constitutively in shoots and roots of seedlings, inflorescent meristems, young flowers, leaves and spikelet hulls and endosperms 4 d after fertilization.The GW2 promoter–GFP expression analysis showed that GFP was strongly expressed in roots , leaves, and floral organs including stamens, pistils and hulls.

Evolution

A.Relationship of ZmGW2-CHR4 and ZmGW2-CHR5. B.Phylogenetic tree of GW2 protein sequences in maize, rice, sorghum and barley. (from reference[2]).

The rice GW2 gene has two co-orthologs located on duplicated chromosomes in maize. Both genes consist of eight exons, with an overall sequence similarity of 94% to each other and 93% to the rice GW2 gene across the coding region. They were named ZmGW2-CHR4 and ZmGW2-CHR5.

You can also add sub-section(s) at will.

Labs working on this gene

1National Key Laboratory of Plant Molecular Genetics, Shanghai Institute of Plant Physiology and Ecology, Shanghai Institute for Biological Sciences, The Chinese Academy of Sciences, 300 Fenglin Road, Shanghai 200032, China.

References

  1. 1.0 1.1 Song, X. J., Huang, W., Shi, M., Zhu, M. Z., & Lin, H. X. (2007). A QTL for rice grain width and weight encodes a previously unknown RING-type E3 ubiquitin ligase. Nature genetics, 39(5), 623-630.
  2. Li, Q., Li, L., Yang, X., Warburton, M.L., Bai, G., Dai, J., Li, J., and Yan, J. (2010). Relationship, evolutionary fate and function of two maize co-orthologs of rice GW2 associated with kernel size and weight. BMC Plant Biol 10, 143.

Structured Information

Gene Name

Os02g0244100

Description

Zinc finger, RING-type domain containing protein

Version

NM_001052949.1 GI:115445268 GeneID:4328856

Length

6429 bp

Definition

Oryza sativa Japonica Group Os02g0244100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:8144222..8150650

Sequence Coding Region

8144506..8144706,8145995..8146046,8146132..8146177,8146270..8146351,8146430..8146592
,8146685..8146787,8148484..8148550,8149829..8150386

Expression

GEO Profiles:Os02g0244100

Genome Context

<gbrowseImage1> name=NC_008395:8144222..8150650 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:8144222..8150650 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggggaacaggataggggggaggaggaaggcgggggtggaggagaggtacacgaggccgcaggggctgtacgagcacagggacatcgaccagaagaagctccggaagctgatcctcgaggccaagctcgcgccgtgctacatgggcgccgacgacgccgccgccgccgccgacctcgaggagtgccccatctgcttcctgtactacccaagtcttaaccgatcaaagtgttgctcaaaagggatatgcaccgagtgctttctccaaatgaaaccaactcacactgctcagcctacacaatgtccattctgcaaaactcccagttatgctgtggagtatcgtggtgtaaagacaaaggaggaaaggagcatagaacaatttgaagagcagaaagtcatagaagcacaaatgaggatgcgccagcaagcacttcaagatgaagaagataagatgaaaagaaaacagaacaggtgctcttctagcagaacaatcacaccgaccaaagaagtggagtatagagatatttgcagcacatccttttcagtgccgtcataccgatgtgctgagcaagaaactgaatgctgttcatcggaaccttcatgctctgcccagactagcatgcgccctttccattctaggcataaccgtgatgataacattgacatgaatatagaggatatgatggttatggaagcgatttggcgttccattcagggaagtatagggaatcctgtctgtggcaactttatgcctgtaactgagccatctccgcgtgaacgccagccattcgttccagctgcttctctagaaatacctcatggtggtggattttcctgtgcggttgcggcaatggctgagcaccagccacccagtatggacttctcttacatggctggcagcagcgcattcccagttttcgacatgttccggcgaccatgcaacattgctggtggaagcatgtgtaatctggagagctcaccggagagctggagcgggatagcaccaagctgcagcagggaagtggtaagagaagaaggagagtgctcggctgaccactggtcggagggtgcagaggccggaacaagctacgcgggctcagacatcgtggcagatgccgggaccatgccgcagctgcctttcgccgagaacttcgccatggcgccaagccacttccgcccggagagcatcgaagaacagatgatgttttccatggctctttctttagcagatggtcatggaagaacacactcgcaagggttggcatggttgtag</cdnaseq>

Protein Sequence

<aaseq>MGNRIGGRRKAGVEERYTRPQGLYEHRDIDQKKLRKLILEAKLA PCYMGADDAAAAADLEECPICFLYYPSLNRSKCCSKGICTECFLQMKPTHTAQPTQCP FCKTPSYAVEYRGVKTKEERSIEQFEEQKVIEAQMRMRQQALQDEEDKMKRKQNRCSS SRTITPTKEVEYRDICSTSFSVPSYRCAEQETECCSSEPSCSAQTSMRPFHSRHNRDD NIDMNIEDMMVMEAIWRSIQGSIGNPVCGNFMPVTEPSPRERQPFVPAASLEIPHGGG FSCAVAAMAEHQPPSMDFSYMAGSSAFPVFDMFRRPCNIAGGSMCNLESSPESWSGIA PSCSREVVREEGECSADHWSEGAEAGTSYAGSDIVADAGTMPQLPFAENFAMAPSHFR PESIEEQMMFSMALSLADGHGRTHSQGLAWL</aaseq>

Gene Sequence

<dnaseqindica>285..485#1774..1825#1911..1956#2049..2130#2209..2371#2464..2566#4263..4329#5608..6165#gcagcagagaggtctccacttccctttcctcccaccccgagaaagccaaaaaaagaaaaattatttttcaaaaaaaaagctcgcctcgccctcgcgtcgtcgtccccatcaccccccctcctccgctccgagtacgcgtgcgtataccaccacctccatctccaccaccgtatgtatctacggtgaggcggcggcggcggaggaggaggaggagggggagtggtgagggtttcatctgcggaggaggagggaggaggagggaggagggtagatctgggagggggatggggaacaggataggggggaggaggaaggcgggggtggaggagaggtacacgaggccgcaggggctgtacgagcacagggacatcgaccagaagaagctccggaagctgatcctcgaggccaagctcgcgccgtgctacatgggcgccgacgacgccgccgccgccgccgacctcgaggagtgccccatctgcttcctggtataaaaccgcctccggggagatgtggcgggtggacgggaggaagagatctctcccctcttcctcacttcctcctcccgcttccttccacttcagctttttctctctttttttttggtgggattttgtcgtaatgctactactagtacttgttgttgcgagagtagggcgtggattgcgtgtggccgggtggtggcgtggagcgtttcgattagggggttgattacttttgctcctgttcgattgtggagagtgccggtggtgtgtggccgttatggagatggatgaccacgcgcagtgttttggggcaagaatttcagtcgacattggcacggttttggggttgtttgtattgttcttggataattagtgcggttcgtggagctgattttgcgaaatgtagtagtagtgtttgaattatttctggtagttagtagtggtatcatacttcgtatgtacattgtccgcaatgttctcctaaattgttttgttttcttaatcatagtttacttacttttattatgtaattctgagatacgtttttttgggataattatagtctaggaggttttgggtactcatttattattgtcaatattctataggcctatctattggctgcctggctgtgatgcattgcatgaaatttaatgtttactgccactcccggggttgggacattacagaccttataggaaatttgactagtttcataaatgaataattggccaactgttctgcaatgttgggtgccttcaatttctaatagtggatgctctatagagtacggaggtaccatggtgatatttgtttgttgtgtgtaatactttatttttggtgtattaatgctcttgggaaccgagattgagaatctattgtagtgaacttgattctgttagctgtgccagagtattttcgatgtctcttgtcaagcctgcatttatttggcacaaagtagattttttaaaaaaaaattctgcagctttaatgctactagcttactgcaattaatgttattactatataggaattttaatgcaattctatatggttgcaattttattgcaattctgcttcattagatctttagctcaaaatcactcaataaatttggttttagatgaaatcatgaaacttgtattataggagtatattatatttggtgttgaattatatgtttgcatttgtgctaatagtggtatttaacaattatcacttctggtatttctgagttcaaactgtttgacaaccactcctgtcctgaaatgcatgttttctttctttgtagtactacccaagtcttaaccgatcaaagtgttgctcaaaagggatatgcaccggtaatacatctatcctataactaacaattgtgttttacttgttaggaccatatacccttatattcaatggttggtttttttgcagagtgctttctccaaatgaaaccaactcacactgctcagcctacacagtatcctttgtgtcacccttgattatattttgtaaccttggcagttggcaatctatattcctttttatgaaaaaaatacttaaccaataaagatgtccattctgcaaaactcccagttatgctgtggagtatcgtggtgtaaagacaaaggaggaaaggagcatagaacaatttgtaagtaatttatattctgatgttttttttttgttttgccaaatgcatttcatttatctcacataatatgtgttacaggaagagcagaaagtcatagaagcacaaatgaggatgcgccagcaagcacttcaagatgaagaagataagatgaaaagaaaacagaacaggtgctcttctagcagaacaatcacaccgaccaaagaagtggagtatagagatatttgcagcacatccttttcaggtctgcacaggctgcaactaacatagaaatttagtaatgtaccatttcttctgcttgatgtggtaatttactatgtgttatgtctgtttcagtgccgtcataccgatgtgctgagcaagaaactgaatgctgttcatcggaaccttcatgctctgcccagactagcatgcgccctttccattctaggcataaccggtatgttattatctttttctctgagttttagggtgtcattgtagcctggttatgttgaactgcaaaccttactacacttctatgttaaataccctacctcaaccatgttgaagggaagcaaatgagaagtattgttaaaataggataaaggaaagtaacagtattatctatagaatcaaatcgataacaaagatcaaccgttggattaaattggatagtggggaccagacaccataaaacactggcatttcggacaagatcatttaattattccactttaagcttgtgcagtctgtcctgatccactgcactatttaagtggatgagaagctgtgattggagttactgttctagtgttaaggttgacttgtatcagatacaattgcctatccagtgacaaagtttgaatgtttaatttgtgaaagtgtgaatggagagaatttctgcccacatcattgttgtaccatgatagttacagtaatctttagtttatctatactctagagggataaaaacaccaaaacagtttgatcaaaattgttcgaggtaaatcctaagtataaaattgagaatggatttgtttttcaatatggttatttgttatcgacattcagtgtttttatttcacacaatggccaattccgaaaaaacaatctgggttctttttatcccactgtccataccaagttgatgtagcaagtaactactacacaaaatagtatattgtagccctttacatgcatccaatagattaagtggtcttcaatccaaggatgaaataagcaataacgtaggttccgataccaaattagcacaaaacaatgctaaatgcttttagaggaagtaaaccactcatttggttcttttacctataaacttgtgttcgcttgatgttctcaatattgtcaggctattttatagacttgaggagtaaacatttcttgatgacgttatcttctcctattgtgctagacataaaatacagtgtagcataacttgtgtactgtgagtttttttcaagtttttcttgatgctgcacaatagtatacaacaatcgtctattcagtcacacatggcacatcctcacatcaaacagaagttactttttatgatgttaatgtgtagtataacagcagaagctaaacggtagagggatacaggatactcgagtcaatatgaagttggggttccatggagtatttgaatcgaataaaacatcttgatgatcaatattggttttcatattgtttctataagctagtttcatatttttctagagaacctattattattttgcttcctgtcctcctcagaagattgacattctgtactggtagtgaatttgtgtttccctcataccctgtttgggagggtttcaacgtcagcttagtgcagtgctgcaaagtttaaactctatgaccagagcataagtatggcttaaggacttctgatgacaaagccatttttgaaacctgaagcctattttgatcaacttatgaacttatatggaaaaccagtttctgaaagaggccaaatatcaataaatggtgccttaatctcccttcagttttatagtttaccatatggatatttttcctgtactaagtgtttcttgcttgctggtcatgataatcctttatgctgttgagatgaaaatggtttctaaaattatgaaactgtgtgtttccccttacagtgatgataacattgacatgaatatagaggatatgatggttatggaagcgatttggcgttccattcaggttagtagttttctcactggtccttacatgagattattgataatatgcatatggcatactgtggataatattataaaagctgatttgttgggtcaggtaatggtttgtaaatgagctgcacaaaaatagattgttatttgcattgaacatgaaagtttgctaatctcctggcatgcttgttgaattcagagcattttgcgagttctgataaatgcaagatctagtctgcacaagcagaacctgtattgttaagtgttcaataataaaaaaaaatgtcaattaaattgttgagaagtgtattggcgatagtggataatgtaggatatgtttggtttgagggaccaacatcagttagttcatcattgcctcattcctcaggcacatgctagtggaaaaatgagtaatgcagtattcatgccaaaatcatcctagatggtgtgattcctcaaacaaaacaggccagtagatgatggggttggtaagataagttatctttttgtcattttacttgagcagtactgcgcttggcacaaaaatatttctggtcattttgtgagaacaagaggacttttcacattcctgcattcctgaagggaacttattatctaacagcattgctaaactcagctcttcccatgcccttagccatcaaattgatttgttatgatggttgcattgttagttttgcggtcccaattattagccacttaacgttcaggtcaggaactaatggtgttttttttctccgtcctttgtgttatactacctccatcctaaaataagtgcagccatgagtttccgcgcccaactttgatcgtccgttttatttgaaatttttttataattagcatttttgttgttataagatgataaaacatgaatagtactttactcgtgacttatgtttttgattttttcaaaaaaatttcaaataagacgaatggtcaaagttgggcgctgaaaaccatggctgcacttattttgggacggaggtagtatcatttattcatttgctgttcaagctgtagctcatcgtgtactgttccccaataagttgcttgccatttggtctatgtttccagcttctttcttttgtgagcatttttccttctgtatagcttgttactagaaagatgtaaactttatgttaaatgctgcttcatctttgaatttagattcttgggaataaacaataagcaaagttcatgtattgcgtatagaaaagtctgcatatatttctatcctaatacggtcaatcttttctctgagcaggagcagggaagtatagggaatcctgtctgtggcaactttatgcctgtaactgagccatctccgcgtgaacgccagccattcgttccagctgcttctctagaaatacctcatggtggtggattttcctgtgcggttgcggcaatggctgagcaccagccacccagtatggacttctcttacatggctggcagcagcgcattcccagttttcgacatgttccggcgaccatgcaacattgctggtggaagcatgtgtaatctggagagctcaccggagagctggagcgggatagcaccaagctgcagcagggaagtggtaagagaagaaggagagtgctcggctgaccactggtcggagggtgcagaggccggaacaagctacgcgggctcagacatcgtggcagatgccgggaccatgccgcagctgcctttcgccgagaacttcgccatggcgccaagccacttccgcccggagagcatcgaagaacagatgatgttttccatggctctttctttagcagatggtcatggaagaacacactcgcaagggttggcatggttgtaggtagagcactctaattttgacgccttgctgccctctcccttgcgctgctgttgctgcccttctctcccctgcctcctgcttctgcctcctttttgccaccagctcttggcctttttgttcaccccttttttgcatgtgttttgtcgtcatggtttgatatagatccagctatagctctccattgttattgcttatatgtatgtaaaatggaatatgaggaaatagaaaaaaggaaaatgggtcaacagttcttttggcagtagg</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0244100, RefSeq:Os02g0244100