Difference between revisions of "Os02g0765600"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
(References)
Line 17: Line 17:
  
 
==References==
 
==References==
Please input cited references here.
+
1. Jirong Huang;Kyoko Toyofuku;Junji Yamaguchi;Shigemi Akita
 +
  Expression of α-amylase isoforms and the RAmy1A gene in rice (Oryza sativa L.) during seed germination, and its relationship with coleoptile length in submerged soil
 +
  Plant production science, 2000, 3(1): 32-37
 +
----
 +
2. Akiyoshi Morita;Taka-aki Umemura;Mitsuyo Kuroyanagi;Yuzo Futsuhara;Pierdomenico Perata;Junji Yamaguchi
 +
  Functional dissection of a sugar-repressed α-amylase gene (RAmy1A) promoter in rice embryos
 +
  FEBS Letters, 1998, 423(1): 81-85
 +
----
 +
3. Ning Huang;Nozomu Koizumi;Stephen Reinl;Raymond L. Rodriguez
 +
  Structural organization and differential expression of rice α-amylase genes
 +
  Nucleic Acids Research, 1990, 18(23): 7007-7014
  
 
==Structured Information==
 
==Structured Information==

Revision as of 11:34, 23 May 2014

Please input one-sentence summary here.

Annotated Information

Function

Alpha-amylase gene, RAmylA, encodes rice α-amylase isoform A.

Expression

A significant difference in the seed germinability was observed between the two rice cultivars, 'Nipponbare' and 'Suweon 287', under anoxia (i.e., during germination in submerged soil at 18℃), although little difference was seen under aerobic (in air) or hypoxic (in water) conditions. The number of α-amylase isoforms synthesized in germinating seeds was inversely proportional to the O2 concentrations at the early germination stage. The formation of isoform B was promoted by oxygen supply, while isoform H was undetectable if the seeds were unable to germinate. The activity of isoform H was highly correlated with the coleoptile length in the submerged soil at 18℃, indicating that isoform H is a critical factor for seed germination under anoxia. The expression of the rice α-amylase RAmy1A gene was repressed when the seeds germinated under hypoxia or anoxia.

Ontology

Gene ontology: The chemical reactions and pathways involve in carbohydrates.


Growth stage ontology: It occurs when the seed coat has imbibed adequate water becoming soft and elastic.

Labs working on this gene

Please input related labs here.

References

1. Jirong Huang;Kyoko Toyofuku;Junji Yamaguchi;Shigemi Akita

 Expression of α-amylase isoforms and the RAmy1A gene in rice (Oryza sativa L.) during seed germination, and its relationship with coleoptile length in submerged soil
 Plant production science, 2000, 3(1): 32-37

2. Akiyoshi Morita;Taka-aki Umemura;Mitsuyo Kuroyanagi;Yuzo Futsuhara;Pierdomenico Perata;Junji Yamaguchi

 Functional dissection of a sugar-repressed α-amylase gene (RAmy1A) promoter in rice embryos
 FEBS Letters, 1998, 423(1): 81-85

3. Ning Huang;Nozomu Koizumi;Stephen Reinl;Raymond L. Rodriguez

 Structural organization and differential expression of rice α-amylase genes
 Nucleic Acids Research, 1990, 18(23): 7007-7014

Structured Information

Gene Name

Os02g0765600

Description

Alpha-amylase precursor (EC 3.2.1.1) (1,4-alpha-D-glucan glucanohydrolase) (Isozyme 1B)

Version

NM_001054755.1 GI:115448880 GeneID:4330832

Length

1846 bp

Definition

Oryza sativa Japonica Group Os02g0765600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:33135190..33137035

Sequence Coding Region

33135415..33135666,33135751..33136562,33136657..33136789,33136898..33137005

Expression

GEO Profiles:Os02g0765600

Genome Context

<gbrowseImage1> name=NC_008395:33135190..33137035 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:33135190..33137035 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgcaggtgctgaacaccatggtgaacaaacacttcttgtccctttcggtcctcatcgtcctccttggcctctcctccaacttgacagccgggcaagtcctgtttcagggattcaactgggagtcgtggaaggagaatggcgggtggtacaacttcctgatgggcaaggtggacgacatcgccgcagccggcatcacccacgtctggctccctccgccgtctcactctgtcggcgagcaaggctacatgcctgggcggctgtacgatctggacgcgtctaagtacggcaacgaggcgcagctcaagtcgctgatcgaggcgttccatggcaagggcgtccaggtgatcgccgacatcgtcatcaaccaccgcacggcggagcacaaggacggccgcggcatctactgcctcttcgagggcgggacgcccgactcccgcctcgactggggcccgcacatgatctgccgcgacgacccctacggcgatggcaccggcaacccggacaccggcgccgacttcgccgccgcgccggacatcgaccacctcaacaagcgcgtccagcgggagctcattggctggctcgactggctcaagatggacatcggcttcgacgcgtggcgcctcgacttcgccaagggctactccgccgacatggcaaagatctacatcgacgccaccgagccgagcttcgccgtggccgagatatggacgtccatggcgaacggcggggacggcaagccgaactacgaccagaacgcgcaccggcaggagctggtcaactgggtcgatcgtgtcggcggcgccaacagcaacgccacggcgttcgacttcaccaccaagggcatcctcaacgtcgccgtggagggcgagctgtggcgcctccgcggcgaggacggcaaggcgcccggcatgatcgggtggtggccggccaaggcgacgaccttcgtcgacaaccacgacaccggctcgacgcagcacctgtggccgttcccctccgacaaggtcatgcagggctacgcatacatcctcacccaccccggcaacccatgcatcttctacgaccatttcttcgattggggtctcaaggaggagatcgagcgcctggtgtcaatcagaaaccggcaggggatccacccggcgagcgagctgcgcatcatggaagctgacagcgatctctacctcgcggagatcgatggcaaggtgatcacaaagattggaccaagatacgacgtcgaacacctcatccccgaaggcttccaggtcgtcgcgcacggtgatggctacgcaatctgggagaaaatctga</cdnaseq>

Protein Sequence

<aaseq>MQVLNTMVNKHFLSLSVLIVLLGLSSNLTAGQVLFQGFNWESWK ENGGWYNFLMGKVDDIAAAGITHVWLPPPSHSVGEQGYMPGRLYDLDASKYGNEAQLK SLIEAFHGKGVQVIADIVINHRTAEHKDGRGIYCLFEGGTPDSRLDWGPHMICRDDPY GDGTGNPDTGADFAAAPDIDHLNKRVQRELIGWLDWLKMDIGFDAWRLDFAKGYSADM AKIYIDATEPSFAVAEIWTSMANGGDGKPNYDQNAHRQELVNWVDRVGGANSNATAFD FTTKGILNVAVEGELWRLRGEDGKAPGMIGWWPAKATTFVDNHDTGSTQHLWPFPSDK VMQGYAYILTHPGNPCIFYDHFFDWGLKEEIERLVSIRNRQGIHPASELRIMEADSDL YLAEIDGKVITKIGPRYDVEHLIPEGFQVVAHGDGYAIWEKI</aaseq>

Gene Sequence

<dnaseqindica>1370..1621#474..1285#247..379#31..138#aatcatccatctccgaagtgtgtctgcagcatgcaggtgctgaacaccatggtgaacaaacacttcttgtccctttcggtcctcatcgtcctccttggcctctcctccaacttgacagccgggcaagtcctgtttcaggtaagagatcgccatgagttgggtttcaggcttcagtgaactgatcgggttttgtactgagcctaagagaatgatgcagtgatgctcttgtgtttgatgatgatgcagggattcaactgggagtcgtggaaggagaatggcgggtggtacaacttcctgatgggcaaggtggacgacatcgccgcagccggcatcacccacgtctggctccctccgccgtctcactctgtcggcgagcaaggtgcggtgctctgctctctcgatcccctccgtcgtcgcaccattgccggcaaaatacatgcacaggtcgttgaattgcttgaatgcttctgcaggctacatgcctgggcggctgtacgatctggacgcgtctaagtacggcaacgaggcgcagctcaagtcgctgatcgaggcgttccatggcaagggcgtccaggtgatcgccgacatcgtcatcaaccaccgcacggcggagcacaaggacggccgcggcatctactgcctcttcgagggcgggacgcccgactcccgcctcgactggggcccgcacatgatctgccgcgacgacccctacggcgatggcaccggcaacccggacaccggcgccgacttcgccgccgcgccggacatcgaccacctcaacaagcgcgtccagcgggagctcattggctggctcgactggctcaagatggacatcggcttcgacgcgtggcgcctcgacttcgccaagggctactccgccgacatggcaaagatctacatcgacgccaccgagccgagcttcgccgtggccgagatatggacgtccatggcgaacggcggggacggcaagccgaactacgaccagaacgcgcaccggcaggagctggtcaactgggtcgatcgtgtcggcggcgccaacagcaacgccacggcgttcgacttcaccaccaagggcatcctcaacgtcgccgtggagggcgagctgtggcgcctccgcggcgaggacggcaaggcgcccggcatgatcgggtggtggccggccaaggcgacgaccttcgtcgacaaccacgacaccggctcgacgcagcacctgtggccgttcccctccgacaaggtcatgcagggctacgcatacatcctcacccaccccggcaacccatgcatcgtgagtagccaactcgatcagaaattctgaatcatcctgcaaactgatcgatgaactgatgataaattctgtaaaattgttcagttctacgaccatttcttcgattggggtctcaaggaggagatcgagcgcctggtgtcaatcagaaaccggcaggggatccacccggcgagcgagctgcgcatcatggaagctgacagcgatctctacctcgcggagatcgatggcaaggtgatcacaaagattggaccaagatacgacgtcgaacacctcatccccgaaggcttccaggtcgtcgcgcacggtgatggctacgcaatctgggagaaaatctgagcgcacgatgacgagactctcagtttagcagatttaacctgcgatttttaccctgaccggtatacgtatatacgtgccggcaacgagctgtatccgatccgaattacggatgcaattgtccacgaagtacttcctccgtaaataaagtgaggatcagggacatacatttgtatggttttacgaataatgctatgcaataaaatttgcactgcttaatgcttatgc</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0765600, RefSeq:Os02g0765600