Difference between revisions of "Os03g0111300"

From RiceWiki
Jump to: navigation, search
(Function)
(References)
Line 19: Line 19:
 
==References==
 
==References==
 
Please input cited references here.
 
Please input cited references here.
 +
J.P Douliez, T Michon, K Elmorjani, D Marion
 +
 +
Structure, biological and technological functions of lipid transfer proteins and indolines, the major lipid binding proteins from cereal kernels
 +
 +
J. Cereal Sci., 32 (2000), pp. 1–20
  
 
==Structured Information==
 
==Structured Information==

Revision as of 12:58, 23 May 2014

Please input one-sentence summary here.

==Annotated Informatio

Function

Please input function information here. NsLTPs bind to a variety of lipid molecules and catalyze their transfer across membranes in vitro [2]. NsLTPs also have additional biological functions, including biosynthesis of cutin, involvement in defense against pathogens, and managing abiotic stress conditions imparted by temperature or drought [2] and [3]. The nsLTP superfamily possesses eight highly conserved cysteine residues forming four disulfide bonds [1] and [4]. NsLTPs are subdivided into two subfamilies that differ in molecular mass, nsLTP1 (9 kDa), and nsLTP2 (7 kDa) [1].

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here. J.P Douliez, T Michon, K Elmorjani, D Marion

Structure, biological and technological functions of lipid transfer proteins and indolines, the major lipid binding proteins from cereal kernels

J. Cereal Sci., 32 (2000), pp. 1–20

Structured Information

Gene Name

Os03g0111300

Description

Nonspecific lipid-transfer protein 2 (nsLTP2) (7 kDa lipid transfer protein)

Version

NM_001055258.1 GI:115450244 GeneID:4331362

Length

476 bp

Definition

Oryza sativa Japonica Group Os03g0111300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:630670..631145

Sequence Coding Region

630809..631099

Expression

GEO Profiles:Os03g0111300

Genome Context

<gbrowseImage1> name=NC_008396:630670..631145 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:630670..631145 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgatgaggaagttggcggtgttggtgttggcggtggcgatggtggcggcgtgcggcggcggcgtcgtgggtgtagcgggggccggttgcaacgctgggcagctgacggtgtgcacgggggcgatcgcgggcggggcgcggccgacggcggcgtgctgctccagcctgcgggcgcagcagggctgcttctgccagttcgccaaggacccgcgctacgggcgctacgtcaacagccccaacgcccgcaaggccgtctcctcctgcggcatcgccctccccacctgccactga</cdnaseq>

Protein Sequence

<aaseq>MMRKLAVLVLAVAMVAACGGGVVGVAGAGCNAGQLTVCTGAIAG GARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH</aaseq>

Gene Sequence

<dnaseqindica>47..337#gtacctcgcagcaccaagctagctagcttcgatcagtagctggaggatgatgaggaagttggcggtgttggtgttggcggtggcgatggtggcggcgtgcggcggcggcgtcgtgggtgtagcgggggccggttgcaacgctgggcagctgacggtgtgcacgggggcgatcgcgggcggggcgcggccgacggcggcgtgctgctccagcctgcgggcgcagcagggctgcttctgccagttcgccaaggacccgcgctacgggcgctacgtcaacagccccaacgcccgcaaggccgtctcctcctgcggcatcgccctccccacctgccactgatccatccatccatcgtctcctactcttttattttgtgatgtggtgtacgtgttcgtagtattgtcttggcgtcatctcgtcacgacgcgtatatgcatgcgcagtgcggcttttgaataaaaggggatcgaccgatgtt</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0111300, RefSeq:Os03g0111300