Difference between revisions of "Os01g0952800"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 5: Line 5:
 
===Function===
 
===Function===
 
   
 
   
== t ==his 
 
 
 
This gene has the activity of transcription, and is an important regulatory factor of grasses in the iron reaction. Under iron deficiency conditions, ''''OsIRO2''''is an indispensable factor for effective absorption to iron. In plants of ''OsIRO2'' RNAi, due to the expression of ''OsIRO2'' declining, the synthesis of mugineic acid is decreased. Meanwhile, the secretion of 2'-deoxy mugineic acid is reduced, resulting in a decrease of iron absorption, so that the iron content in the plants drops, leaves yellowing and its growth is inhibited. Under conditions of iron deficiency, unknown transcription factor binds into the promoter of iron deficiency ''OsIRO2'' response cis-acting elements (IDE), to adjust the expression of ''OsIRO2'', then ''OsIRO2'' binds to the related gene or promoter sequences which is CACGTGG about iron absorption, regulating the expression of these genes, and promoting the absorption of iron in rice under iron deficiency conditions[[1]].
 
This gene has the activity of transcription, and is an important regulatory factor of grasses in the iron reaction. Under iron deficiency conditions, ''''OsIRO2''''is an indispensable factor for effective absorption to iron. In plants of ''OsIRO2'' RNAi, due to the expression of ''OsIRO2'' declining, the synthesis of mugineic acid is decreased. Meanwhile, the secretion of 2'-deoxy mugineic acid is reduced, resulting in a decrease of iron absorption, so that the iron content in the plants drops, leaves yellowing and its growth is inhibited. Under conditions of iron deficiency, unknown transcription factor binds into the promoter of iron deficiency ''OsIRO2'' response cis-acting elements (IDE), to adjust the expression of ''OsIRO2'', then ''OsIRO2'' binds to the related gene or promoter sequences which is CACGTGG about iron absorption, regulating the expression of these genes, and promoting the absorption of iron in rice under iron deficiency conditions[[1]].
  

Revision as of 09:02, 24 May 2014

Please input one-sentence summary here.


Annotated Information

Function

This gene has the activity of transcription, and is an important regulatory factor of grasses in the iron reaction. Under iron deficiency conditions, 'OsIRO2'is an indispensable factor for effective absorption to iron. In plants of OsIRO2 RNAi, due to the expression of OsIRO2 declining, the synthesis of mugineic acid is decreased. Meanwhile, the secretion of 2'-deoxy mugineic acid is reduced, resulting in a decrease of iron absorption, so that the iron content in the plants drops, leaves yellowing and its growth is inhibited. Under conditions of iron deficiency, unknown transcription factor binds into the promoter of iron deficiency OsIRO2 response cis-acting elements (IDE), to adjust the expression of OsIRO2, then OsIRO2 binds to the related gene or promoter sequences which is CACGTGG about iron absorption, regulating the expression of these genes, and promoting the absorption of iron in rice under iron deficiency conditions1.

Expression

Please input expression information here.

   In the iron-sufficient conditions, there is no significant difference between the plants of overexpression OsIRO2 and OsIRO2 RNAi and wild type of

plants; under iron deficiency conditions, the growth of OsIRO2 RNAi plants is inhibited, their leaves yellowing, while the growth of OsIRO2 overexpression plants can continue, and plant height is higher than that of wild-type and OsIRO2 RNAi plants2.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Institute of Crop Science, Chinese Academy of Agricultural Sciences

References

Please input cited references here.

1. Yuko Ogo;Reiko Nakanishi Itai;Hiromi Nakanishi;Haruhiko Inoue;Takanori Kobayashi;Motofumi Suzuki;Michiko Takahashi;Satoshi Mori;Naoko K. Nishizawa. Isolation and characterization of IRO2, a novel iron-regulated bHLH transcription factor in graminaceous plants. Journal of Experimental Botany, 2006, 57(11): 2867-2878.
2. Yuko Ogo;Reiko Nakanishi Itai;Hiromi Nakanishi;Takanori Kobayashi;Michiko Takahashi;Satoshi Mori;Naoko K. Nishizawa. The rice bHLH protein OsIRO2 is an essential regulator of the genes involved in Fe uptake under Fe-deficient conditions. The Plant Journal, 2007, 51(3): 366-377.

Structured Information

Gene Name

Os01g0952800

Description

Basic helix-loop-helix dimerisation region bHLH domain containing protein

Version

NM_001051959.1 GI:115442288 GeneID:4325750

Length

6650 bp

Definition

Oryza sativa Japonica Group Os01g0952800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:43766291..43772940

Sequence Coding Region

43770559..43770642,43771987..43772343,43772434..43772736

Expression

GEO Profiles:Os01g0952800

Genome Context

<gbrowseImage1> name=NC_008394:43766291..43772940 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:43766291..43772940 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggagcagctgttcgtcgacgacccagccttcgcgagcagcatgtcgtcgcttgaggcggacatcttctccggcgccggccagctgccgtcctcgccgtggctggacctagacctcgacgacgatgtccaagacctctccatggcgccgacgacggcgaacgcggtgtcctccggctacggctccggcggatccggctcccacaggaagctcagccacaacgcctacgagcgcgaccgccggaagcagctcaacgagctctactcctccctccgcgctctcctccccgacgccgatcacactaagctgagcatcccgacgacggtgtctcgcgtgctcaagtacatacccgagctgcagaagcaggtggagaatctggagaggaagaagaaggagctgacgacgacgagcaccaccaactgcaaaccaggagtgttggggagccagctgatgagcgagggcatggctcccatcgtttcggctacctgcatcaatgacatggagatcatggttcaggtcagcttgttgagcaatgtggcgggttcagttcttcctctctccaagtgtatcaaagtactggagaacgaaggtcttcacttcatcagttcatcgacttcctccggatttgggaacaggacattctacagtatccatcttcagagaagtgaaggaacgatcaacgaggagtgcccagcattttgtgaaaggttggagaaagtcgtcaggaacaaagcaaagctttaa</cdnaseq>

Protein Sequence

<aaseq>MEQLFVDDPAFASSMSSLEADIFSGAGQLPSSPWLDLDLDDDVQ DLSMAPTTANAVSSGYGSGGSGSHRKLSHNAYERDRRKQLNELYSSLRALLPDADHTK LSIPTTVSRVLKYIPELQKQVENLERKKKELTTTSTTNCKPGVLGSQLMSEGMAPIVS ATCINDMEIMVQVSLLSNVAGSVLPLSKCIKVLENEGLHFISSSTSSGFGNRTFYSIH LQRSEGTINEECPAFCERLEKVVRNKAKL</aaseq>

Gene Sequence

<dnaseqindica>2299..2382#598..954#205..507#gctggcctaagctaactcaatcaaacctccctagcttggcagaatagttaatgttaatcacctgattaaaattagattagtcccctcctacccagctaactactgcttctatttcacggagaaaaatgtcttcctaggctttctctttcagctcgatcgatccacagctcagctagctctctctctctctagcgacaagcaagcatggagcagctgttcgtcgacgacccagccttcgcgagcagcatgtcgtcgcttgaggcggacatcttctccggcgccggccagctgccgtcctcgccgtggctggacctagacctcgacgacgatgtccaagacctctccatggcgccgacgacggcgaacgcggtgtcctccggctacggctccggcggatccggctcccacaggaagctcagccacaacgcctacgagcgcgaccgccggaagcagctcaacgagctctactcctccctccgcgctctcctccccgacgccgatcacactgtaatttaatttacacaaaaccaatcaaatccagtacaccaaattaaccatgcatatgcatgagatcttgatgtgattttgctgcagaagaagctgagcatcccgacgacggtgtctcgcgtgctcaagtacatacccgagctgcagaagcaggtggagaatctggagaggaagaagaaggagctgacgacgacgagcaccaccaactgcaaaccaggagtgttggggagccagctgatgagcgagggcatggctcccatcgtttcggctacctgcatcaatgacatggagatcatggttcaggtcagcttgttgagcaatgtggcgggttcagttcttcctctctccaagtgtatcaaagtactggagaacgaaggtcttcacttcatcagttcatcgacttcctccggatttgggaacaggacattctacagtatccatcttcaggtacacattatacacacagctctatgctagaacgtttaattaatatttcttatggtaatatatttttgaaaagaaaatccctctatactatctccattctaaaatataaaaacatagagcccggacagactgtctatccagatttgtagtacgagtaattaaatgtctcatacgattctattaggttttttatattttagaatggatggagtattttcgatcaacaataacctagcatcaaatcaaggactagagtcaggttaagatccgggtaaattagataaagggtgctatagtacaatctagtgatactactactctgccttaaaatagtttctttttagctatttactcgtatatataccactgttcaagttcataactaaacatataggttttttaagatgaaggtagtagtaaatatgagtaaattttatacaactatgagtatattgaataatattatagaactatacttttatatagcacactgtcataaaattagagacttaatactacacatttaaaccacaataacacgaactatatagttgtatatatggcacaaatctagtatagaatatatcatagaactacatattttaataagccatggatctagtaacacaaattacagatttaaatagtggtaaattttattaaaagttatatatattctaaaatttctatcgaaacaacaatgttagctagggatctactatttacaaattacaatatactattttgcaacaaatttgatgctaggtccatagtttttcataggtggtttaatcttgcaaaattgaaaaaacttgtggcaaatttgcaaatgcccctttaatctaccgtttatgctcatagtttgatgttcaatccataattatgtaatattttgcatagtaacagatgagagaaattataagtgaataagatgaaattctactataatcatgagagatatagtagtccctgaatcgtgtgtggaattcatcagctagttgtttttaagatttcaattagagctgaccttcttatgataaaaaccaatgtttcttagtcacaaatctcaaaatatacttgttaaatcgaagatatatgaatcacatgataattgtaaaaatatatgtagcgttactcatgatactaatacttgagataaccctctaaaaatacgggatattacatatgaaagtttctccttgtttgggttaaaattgacagtagagcatgtttgtgtgtatatatagcgtacaattagaccgttatttagttgtcatagaagttcggtgttctgaaaattactcacagttttcatttatatatatgtatctaatgttgaaacagagaagtgaaggaacgatcaacgaggagtgcccagcattttgtgaaaggttggagaaagtcgtcaggaacaaagcaaagctttaagcactagtaccgcgcgcgcgtgcctatgataatcctgaattaatcaagggccaaaatctaggtaaaaatgaccatgcgcagttgttaaatatagcatttggttagctgataataatgatatataagtagtgtgctcgatttatattaactaatttctatgacatatatactatgttgctcgatgtagcttttgtacatatttcatgcatgactctcagtgtattaattaattatattatgagatttgcaaaatgttaatttttgcaatgcttaacgttgctggaggaaaatcaaaccttaagaatatattactttcgtccgctaatataagggattttgacattttacttgtactgtttggccattcgtgttattcaaaaaaatttagaattattatttattttatttgtgacttactttattatccaaagtactttaagcacaacttctctttttttatatttgcacaatttttttaaataagacgagtggtcaaacagtgcaaacaaaatgtcaaaaatcccttatattaggggacggccggagggagtaagtatgtttccggacatgctatatatcactcgacatattttaaagagagatcatacgaatttctaatcttaagatctacttcacgacctccttctccagctttgacaaactctaccgagctccctagtggtcaattagctagggttgtggagtgggtggtgttccacggtttatagggatgctaattaatctactccctccgtccctaaatattttgacgtcgttgacttctaaatatgtttaaccattcgtcttaatcaaaaaatttaagtaattattaattctttttctatccttcgattcaatgttaaatatacttttatgtatacatatagttttacatatttcataaaagttttttaataagacaaacagttaaacatgtttaaaaaagtcaacggcgataaatatttagggacggatggagtatatttttgcgcaagttatgggaggaaaatatgaggacgcacatcctgaagagtacttaaaagaagataatgcatgcaaatacactgcaacctgcatccatggattaattgggatcttattttttcgcttatgcttatgcttatcaaccaaaatttaaattttcaatcttaaatttggatctaattttgatagttttttcattaaagtttatttttcagcctttgcttttagatcgctaagaatacatatataaaagttttattcacaaattatttttcgtttgtaaatatgtcgtttggcttatttcacgaataagcgaaacaatgacgctcttggattcttctccttaggtactactctctctattctaaaatgtggtgtactactagtatttcatctgaaaattaaccgagcaccagctgacagtacttgcacatctacattacagtatgtactagcagaagtaaatgtacttgcgcgctctgtactagcaaccaggagcaagctgatcgtactcacatgcaacaagtttgtggataaggcgtactcctacgtttttgcagttaattaacataaatagggcgagagaggaggattagtgtaattatatatgcaaagactaaagacctttcctgcaaatatttctgaggatgtcgaaggtgttatcaaaaagtgtcttttccattgcaattccagactaggcacaaattaaatttcgtaggctttgggggctttctgcgtgttatgaggaccaataatgaggtctcatcctagctaatttgctgaaatcggccgagatcttatagcagaccatatggaccgcatcatagcatgaactatgcttaggtttggctcttactttaaccgggtaaagagttgaatcgtaccaaacatgtcacgagccacatccaaatttgatttttttttcgcaaacgtgcaaaaaaattgcacgtcaatatattagaagaagagagcatagtttaattacacaacacacacggtcagaaggccgttgccaggggtcaaagaaaaaaagaaaaaaaacagataagctactaagaaagtaaaaactcatatcgcaagagagggtggggtagggggtcctactacactctggcctgcgccagaggcagcgagtcggagaagagagaagagaaggtcattgcgtgatctggagggaggggttgagagaagaggccgttgtaagccgcaacagcctcagttgacacaggacccttctcagacaccattccaagcttgcgcttcagattgtgctaggcgcgtgaggtcatgtcactcgggcaggcgagcgcgagcttggccgcaatcctcttgctacttttcggcacttcttccacggtggcatgcaattcgtggatccggtggcactaatacagttttgagatttcgtggatgatttcatctaaatgaagtccaggatctggtggcgattctatctatattgaagtccatgacatttatactctctttgtttcagactataaattcattttgactttagtcaaagtcaaactactttaagtttagttaagtttataaagagatatagtactcatatttacagcaccaaattagtttcattaaatcaataattgaatatatttatcttgggctaaaatgttactattttttcattaaacttaattaaacttaaaacaatttaactttgacaaaaaccacaatgacttatagtctgaaatggaggaagtatcgtttaatttgagactttgaatacttaatttacaaagaagtgtgtatttgtgccgtgttttctcgctctatatatatcgcagtttcacccatctaattagttgaacagtgcgtcttaatctcaatctccattcgccaattgactgtacatgtctgaatggaatccttctatgtattatctgcacagctagaatcctacaactagcgtagtgtggtggtggtcgtcttcgagttcgacgcgccgccgccgccgctcatcgcgacgacaagagcctcgccagcgtccgcagtagcagcttcctagtcttgttgcactccgagatcgtctccagcctcggcgaccacggctggttcctccgccccatcagcagcgcgtaatgccgcttcagctccggcgtgctgcacagctccgtcgccgtcgccgtcgccgtcgtcgacggcttccggcggcgcgcaccgccgccgttctcgtcgcagctgatcaccttctcgatgaactccgggaggactcggatgagcgtggcgccgccctcgcccttgacgtactcgaacgggcactgccccggcccagccacggacacctttttcgacggcgccggcgacagcgacgcgagcgccgcggcggtgagcaccttgaagcaggagaagcgctcggcggggaggacgaagtacgtccgccccgccatcagctcctcgccggcggacaccaccgggatcgggaggccgacgtagaaggagtcggccgcgcagacgacgtggtcaccggggagctccgccgtgacgtcccccgccacggcgcacaccccgccatcgtcgtccagcatcctcgtctgcccgccccagtacaccagcttcacccccgccgccgccgtcgccggcaggtgcatgcacggggagaggccgttgcccatggcaactgatgtgtctagaaccttctagaacgagctcgagcttgcagatggaagaagaggagaagaggagatgcttgtgtgaattggggctcgtggttgcgagaggggaatatatataagcgagcgttgaacggggttgactttggaaaattcaaagatggaggaggtaaatactcctactactactggtctggcttggtcagcggtcaaaggcgatggcttttgagacggaagcgggtcacgtggcagctgccgattgggccgcggagggggagaagcgagttgcgcgtgcgcatcgtcgttggtcggtgtcgccgatcgggttggatccaaccagatattcagaatttcagatcagatgcacagtagtacagttgcaagttgcaactagaagttgccgattaatttgacagcgcctggctgcaggctgctaccgcactccaacgccgacatggcaggtgtttttttttaaaaatcttgttccaaatttggagctgactgaagagagttttatactccgtattatgggtatgagttcatttatactcctatgtcacttatcatcgatttgttttcggacttattcactttgtagctattttcaaccattacaaaatttaacaattcccataattttagcaaatt</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0952800, RefSeq:Os01g0952800