Difference between revisions of "Os05g0486100"

From RiceWiki
Jump to: navigation, search
(Wild Type VS. Mutant)
(Annotated Information)
Line 23: Line 23:
  
 
This gene is predominantly expressed in root tips, leaf blades, and undifferentiated suspension cells, and is markedly induced by treatment with auxin or ABA.
 
This gene is predominantly expressed in root tips, leaf blades, and undifferentiated suspension cells, and is markedly induced by treatment with auxin or ABA.
 
+
[[File:4.jpg]]
The expression of OsRPK1 in different tissues was analyzed by realtime quantitative PCR. The results showed that OsRPK1 had a higher expression in root tips and leaf blades.Compared with the roots, the expression of OsRPK1 was reduced 5-fold in the stem and 2-fold in the leaf sheath. Real-time PCR analyses showed that the expression of OsRPK1 was induced mainly by exogenous auxin (2,4-D and IAA) and ABA within 12 h of treatment.<ref name="ref1" />[[File:333.jpg|left|thumb|300px|Fig.4 Top:Tissue specific expression of OsRPK1 in wild-type rice plants  Bottom: Relative expression levels of OsRPK1 in the roots of 2-week old wild type seedlings with reagents treatment for 0 h and 12 h]] (Fig.4)
+
The expression of OsRPK1 in different tissues was analyzed by realtime quantitative PCR. The results showed that OsRPK1 had a higher expression in root tips and leaf blades.Compared with the roots, the expression of OsRPK1 was reduced 5-fold in the stem and 2-fold in the leaf sheath. Real-time PCR analyses showed that the expression of OsRPK1 was induced mainly by exogenous auxin (2,4-D and IAA) and ABA within 12 h of treatment.<ref name="ref1" />
  
 
===Evolution===
 
===Evolution===

Revision as of 02:30, 25 May 2014

Please input one-sentence summary here.

Annotated Information

Fig.1 Top:1-week-old seedlings Bottom: 4-week-old seedlings
Fig.2 Top: Roots of 10-day-old plants Bottom: Roots of 4-week-old plants
Fig.3 Top: Histology of root apex visualized on optical longitudinal sections of living embryonic primary roots Bottom: Longitudinal sections of primary root

Function

This gene encodes a Ca2+-independent Ser/Thr kinase which is induced by auxin and abscisic acid (ABA). The novel leucine-rich-repeat receptor-like kinase affects the root system architecture by negatively regulating polar auxin transport in rice.[1] Knockdown of OsRPK1 promoted the growth of transgenic rice plants, and increased plant height and tiller numbers. In contrast, over-expressing plants showed undeveloped adventitious roots, lateral roots, and a reduced root apicalmeristem. OsRPK1 over-expression also inhibited the expression ofmost auxin efflux carrier OsPIN genes, which was accompanied by changes in PAT and endogenous free IAA distribution in the leaves and roots.

Wild Type VS. Mutant

Three under-expressing lines:A5, A7, A9

Three over-expressing lines: O1, O7, O8

One week after germination, the growth of the primary embryonic root was delayed in the over-expressing lines, whereas the under-expressing lines had more adventitious root production compared with WT. At the seedling stage, over-expressing lines exhibited significant shorter shoot height and less fresh weight compared with the WT or under-expressing lines. From the seedling to the tillering stage, under-expressing lines had an increased tiller number compared with the WT and over-expressing lines. At the ripening stage, there were significant differences between WT and the transgenic lines in the total and effective tiller number per plant. ComparedwithWT, over-expressing lines showed a 25% decrease in the effective tiller number, leading to a 27% reduction in grain yield per plant(Fig.1)

Over-expressing lines had a smaller root system and fewer adventitious roots . Lateral root formation was severely defective in over-expressing lines. (Fig.2)

Under-expressing lines had well-developed meristems and elongation zones compared with WT, which were slightly defective in over-expressing plants.(Fig.3)

Expression

This gene is predominantly expressed in root tips, leaf blades, and undifferentiated suspension cells, and is markedly induced by treatment with auxin or ABA. 4.jpg The expression of OsRPK1 in different tissues was analyzed by realtime quantitative PCR. The results showed that OsRPK1 had a higher expression in root tips and leaf blades.Compared with the roots, the expression of OsRPK1 was reduced 5-fold in the stem and 2-fold in the leaf sheath. Real-time PCR analyses showed that the expression of OsRPK1 was induced mainly by exogenous auxin (2,4-D and IAA) and ABA within 12 h of treatment.[1]

Evolution

Receptor-like kinases (RLKs) are a family of transmembrane proteins with versatile N-terminal extracellular domains and C-terminal intracellular kinases.Analysis of four fungal, six metazoan, and two Plasmodium sp. genomes indicates that the family was represented in all but fungal genomes, indicating an ancient origin for the family with a more recent expansion only in the plant lineages.

None of the four fungal genomes examined contained recognizable RLK/Pelle family members. However, the presence of family members in Plasmodium sp. and animal genomes suggests an origin for the RLK/Pelle family in a common ancestor of all genomes examined. The consistently low gene numbers in genomes other than Arabidopsis suggest that a dramatic expansion occurred in the plant lineage. On the other hand, the absence of family members in the fungal genomes examined indicates the RLK/Pelle family may be lost in fungal lineages after fungus-metazoan split.[2] [3]

Labs working on this gene

1.Dept. of Biochemistry & Molecular Biology, College of Life Science, Nanjing Agricultural University, Nanjing 210095, China

2.Japan Biological Information Research Center

3.EMBL Outstation–European Bioinformatics Institute, United Kingdom

4.Department of Biology, McGill University, Canada

5.Department of Genetics, The University of Georgia, USA

6.Center for Information Biology and DNA Data Bank of Japan

7.Graduate School of Information Science and Technology, Hokkaido University, Japan.

References

1.Yu Zou, Xiaoyu Liu, QingWang, Yu Chen, Cheng Liu, Yang Qiu,Wei Zhang, OsRPK1, a novel leucine-rich repeat receptor-like kinase, negatively regulates polar auxin transport and root development in rice, Biochimica et Biophysica Acta 1840 (2014) 1676–1685

2.Shin-Han Shiu and Anthony B. Bleecker, Expansion of the Receptor-Like Kinase/Pelle Gene Family and Receptor-Like Proteins in Arabidopsis, Plant Physiol. 132 (2003) 530–543.

3.S.H. Shiu, A.B. Bleecker, Plant receptor-like kinase gene family: diversity, function, and signaling, Sci. STKE 2001 (2001) RE22.

4.Cui-Cui Shi1, Cui-Cui Feng1, Mei-Mei Yang, Overexpression of the receptor-like protein kinase genes AtRPK1 andOsRPK1 reduces the salt tolerance of Arabidopsis thaliana, Plant Science 217– 218 (2014) 63– 70

5.Takeshi Itoh, Tsuyoshi Tanaka, Roberto A. Barrero, Curated genome annotation of Oryza sativa ssp.japonica and comparative genome analysis with Arabidopsis thaliana, Genome Research 17:175–183 2007

6.Tsuyoshi Tanaka1, Baltazar A. Antonio1, Shoshi Kikuchi, The Rice Annotation Project Database (RAP-DB): 2008 update, Nucleic Acids Research, D1028–D1033 ( 2008)

Structured Information

Gene Name

Os05g0486100

Description

Protein kinase-like domain containing protein

Version

NM_001062412.1 GI:115464554 GeneID:4339142

Length

5961 bp

Definition

Oryza sativa Japonica Group Os05g0486100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:23946647..23952607

Sequence Coding Region

23946795..23947319,23947773..23948005,23948130..23948489,23948666..23948824,23949107..23949585
,23949694..23949825,23949911..23949982,23950073..23950147,23950232..23950300
,23950375..23950446,23950546..23950617,23950698..23950769,23950876..23951037
,23951136..23951207,23951305..23951379,23951965..23952036,23952131..23952251
,23952401..23952488

Expression

GEO Profiles:Os05g0486100

Genome Context

<gbrowseImage1> name=NC_008398:23946647..23952607 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:23946647..23952607 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggagccgcgggtgttgatggctcttgcgctggtggtggtggcggcgggcgtgccggcggtgttgtgccagaccaacgcccaggacgctgcggcgctcgaggggctgaagagccaatggacgaactacccgttgagctggaactccggcgacccctgcggcggcggatgggacggcatcatgtgcaccaacggcagggtgacgacgctgaggctgtcaagcgtcagcctgcagggaacactgagcagcagcatcggccagctcggccagctcacgtacctggatctttccttcaacatcaatctcggtggtccgctgccagctgagattgggaaccttggggagcttacgacactgatcttagctggttgcagcttcactggaaacattccaatagcaataggcaacctgcggaaacttgggttcttggccttgaattcaaacaagtttagtggtggaataccgtcttcgattggcgtactcacaaacctcttatggctagacctggctgataatcaactcactggatctgtccccatctcaacatcaacatcaccaggcctggaccaacttgtcaaaacgcagcacttccatttcaacaagaaccagttaactggaacgcttactggacttttcaactccaatatgactctcatacacattttgtttgatagcaacaaattctcaggctcaatcccagctgaggttgggactgttagtacactcgaagttctccgattggataggaatggttttacgggagcaatacctgctacaattggcagtttggtcaaactgaatgagctgaacttagcaaacaacaagctaactggatcagtgccagatctcagcaacatgaccaacttgaatgttgtggatttgagcaacaacacatttgatccttcagtggcccccagctggttcacatctttaacatctcttgcttctgtttcaatagtttctggaagtctttctggccaggtcccaaaggggctcttcacattgcccacactgcagcaagttgtgctgagcaacaaccaattcaacgggacacttgaaattacaggcaacatcagcagctcactgcagacagtaaatctcatggacaaccgaatagtttctaccgatactgcaagctacaagaaaactctactcctggcaggtaatccgttttgcgccgagcaagatcccaacaacagagccttctgcagcaggcagctacagaacgcgagcccatacagtaccagtatggaaaaatgcggctcagctcagtgcagtgatggtcagaacgtgaaccctgcaagctgcggctgtgctttctcatacaacggcaagatggttttcagggcacccttcttcgtcgacttggtgagcagtacgccgttccagctgctggagtcgaccatggcggcaaagctgaacctgctccctggctcggtcgctctctcagacatccacttcaacagtgacaactacctccaagttcaagtgaagctgttcccaacatccggggtgaccttcaacctgtcagaattgacaaggattggttcttctctcagtaaccagatttacaaaccaccagcaaattttggaccttatttcttcattgcagacccatatgcccccttggcagttgctcttggtggcaaaaaatccaagatgagcacaggtgccatagctggaattgcagtagccggtggggtccttgttatcgccctcattttcatgtcattgtttgctctccgacagaagagaagggctaaggaactcaaggaaagagcagacccttttgcttcatgggctgctggccagaaggacagtggaggggctccacagctgaagggagcaaggttcttctcctttgacgagctcaagatctgcaccaacaacttctctgacaaccacgagatcgggtcaggaggctacgggaaggtgtacagagggattctcggtgacggaacccgtgtcgccatcaagcgtgcagaccgcaactcaatgcagggcgctgtggagttcaagaacgagatcgagctgctgtccagggtgcaccaccgcaacctggtcagcctcattggcttctgctacgagcaaggtgaacagatgctcgtctacgagtacatctccaatggcacactcagagagaacttgacgggaagtgggatgtacttggactggaagaagaggctgaggatcgcgcttggctcggccagagggcttgcctacctgcacgagctcgctgacccaccgatcatccaccgcgacatcaagtccaccaacatcctcctcgacaacaacctcaaggccaaggttgccgacttcgggctctccaagctcgtggccgacactgagaagggccatgtctccacccaagtcaagggaacactgggctacctggacccggagtactacatgacgcagcagctgtcggagaagagcgacgtgtacagcttcggggtggtgatgctggagctggtgagcgggaggcagccgatcgagaaggggcggtacgtggtgcgggaggtgcggctggccatcgacccggccgaccacgaccaccactacggcctccgcgggatcgtcgacccggccatccgcgacgccgcgcgcaccccggtgttccggcggttcgtgcagctggcgatgcggtgcgtcgacgagtcggcggcggcgcgcccggccatgggcgccgtggtgaaggagatcgaggccatgctgcagaacgagcccgacgacgccggcgccggggagggggacagctccgccgacccgtccgccaacgagttcgaccgccaccgcggcggtggcggcccgccggcgcacccctacagcgacgtggagatcagccggggatcgtacgccggcgatggcgcgtcggattacatgccctattttgaggtcaagcccaagtag</cdnaseq>

Protein Sequence

<aaseq>MEPRVLMALALVVVAAGVPAVLCQTNAQDAAALEGLKSQWTNYP LSWNSGDPCGGGWDGIMCTNGRVTTLRLSSVSLQGTLSSSIGQLGQLTYLDLSFNINL GGPLPAEIGNLGELTTLILAGCSFTGNIPIAIGNLRKLGFLALNSNKFSGGIPSSIGV LTNLLWLDLADNQLTGSVPISTSTSPGLDQLVKTQHFHFNKNQLTGTLTGLFNSNMTL IHILFDSNKFSGSIPAEVGTVSTLEVLRLDRNGFTGAIPATIGSLVKLNELNLANNKL TGSVPDLSNMTNLNVVDLSNNTFDPSVAPSWFTSLTSLASVSIVSGSLSGQVPKGLFT LPTLQQVVLSNNQFNGTLEITGNISSSLQTVNLMDNRIVSTDTASYKKTLLLAGNPFC AEQDPNNRAFCSRQLQNASPYSTSMEKCGSAQCSDGQNVNPASCGCAFSYNGKMVFRA PFFVDLVSSTPFQLLESTMAAKLNLLPGSVALSDIHFNSDNYLQVQVKLFPTSGVTFN LSELTRIGSSLSNQIYKPPANFGPYFFIADPYAPLAVALGGKKSKMSTGAIAGIAVAG GVLVIALIFMSLFALRQKRRAKELKERADPFASWAAGQKDSGGAPQLKGARFFSFDEL KICTNNFSDNHEIGSGGYGKVYRGILGDGTRVAIKRADRNSMQGAVEFKNEIELLSRV HHRNLVSLIGFCYEQGEQMLVYEYISNGTLRENLTGSGMYLDWKKRLRIALGSARGLA YLHELADPPIIHRDIKSTNILLDNNLKAKVADFGLSKLVADTEKGHVSTQVKGTLGYL DPEYYMTQQLSEKSDVYSFGVVMLELVSGRQPIEKGRYVVREVRLAIDPADHDHHYGL RGIVDPAIRDAARTPVFRRFVQLAMRCVDESAAARPAMGAVVKEIEAMLQNEPDDAGA GEGDSSADPSANEFDRHRGGGGPPAHPYSDVEISRGSYAGDGASDYMPYFEVKPK</aaseq>

Gene Sequence

<dnaseqindica>5289..5813#4603..4835#4119..4478#3784..3942#3023..3501#2783..2914#2626..2697#2461..2535#2308..2376#2162..2233#1991..2062#1839..1910#1571..1732#1401..1472#1229..1303#572..643#357..477#120..207#gcgcggactcttctcctcttcttcctccacctcctcctccacgatctccggtcaagcagagcacaagcgtgtgctagctctcccggtggcttgcctcgccggcgacggcgcggcgcaggatggagccgcgggtgttgatggctcttgcgctggtggtggtggcggcgggcgtgccggcggtgttgtgccagaccaacgcccaggacggtgagtgctcttgcctcgccgccggcgatcacctccgtttcttccatagatgattctaaagtcaggcaggatcttcttgcccggagaagaatcgcttggtttttgttgctggtgttgatgatcttcttcttgggcatgcatgcgtgcagctgcggcgctcgaggggctgaagagccaatggacgaactacccgttgagctggaactccggcgacccctgcggcggcggatgggacggcatcatgtgcaccaacggcagggtgacgacgctgtaagttacagccatctccttctcctcctaccaccaatatcatgtgatgggccttcctctgaaatcgtgccatggatgtctctggtttttgcaggaggctgtcaagcgtcagcctgcagggaacactgagcagcagcatcggccagctcggccagctcacgtacctgtaagcaccttcttctatcatcagttcatcacccagcttagcaaaagttcaaaacagcatgattttgcaggctatgaacttgggattttcgaaattttgttcatgcttctgtagcagttcagattgtgaattcaggcaatcaggctaggaacttctgattgaaccagtcaaggggcagattgtcagaacagtttgcttctagtttatgaactctgcttttttttttcttgaggcttagttcagctgaccagttcatgtttaccaatcttaagctttgactatttcggcaatgtgacatggattaggttcatttcttaccaaatgaaagaaacaaagatatgatgccaagttacaatagtaaatagatctggatgaaatatctgaagctttgactattttcgcaatgtgacatggattaggctcatttcttaccaaaagaaagaaacaagatactacacttgaagttaaattatcaatagcaaacgtacctggatgaaatgatccgtgacaaagttctggagtacaactaatttgtctaagaagaaatagtctagtagtagtagctgataacagaaacacttgcagggatctttccttcaacatcaatctcggtggtccgctgccagctgagattgggaaccttggggagcttacgacactgtatgcgccgcactgcccattgttgtcaacactactttttccaatcagaaataccaaactttcttactgatgtgcacaaatgctgtgtaattgtcaggatcttagctggttgcagcttcactggaaacattccaatagcaataggcaacctgcggaaacttgggttcttgtaagtggatatacctggtccacagtttcagatgataaaccctttttttcttttcttttgagtggattgacataatgaattcgtgccattctctatagggccttgaattcaaacaagtttagtggtggaataccgtcttcgattggcgtactcacaaacctcttatggctagacctggctgataatcaactcactggatctgtccccatctcaacatcaacatcaccaggcctggaccaacttgtcaaaacgcagcacttgtaagtaattttaatcttactttatggtattatcaattgagaaatatcagaatatgtaagtacttacaattgattgttttgctccaaacttcaaattgatgaacagccatttcaacaagaaccagttaactggaacgcttactggacttttcaactccaatatgactctcatacacatgtaagggatcgacaaattttcatgtctaatatgaataccgaatagatatatcttgctaacatctctccctatctcgtcagtttgtttgatagcaacaaattctcaggctcaatcccagctgaggttgggactgttagtacactcgaagttctgtaagtatcttgaaagttcacataggtggaactcatccttttattttctccaaaaaaaaaaatggtcatatctttgacttgcttttgtatctttgacagccgattggataggaatggttttacgggagcaatacctgctacaattggcagtttggtcaaactgaatgagctgtaagtgacatctgatcttaaaggaagagttatgacacttgaggcacctctcttgaaaatgttatcttctgcaggaacttagcaaacaacaagctaactggatcagtgccagatctcagcaacatgaccaacttgaatgttgtgtaagaaactaaccacccccatgcctcatcatccaatcatataatttgtctgcataactaaagattccactcttgaattgccagggatttgagcaacaacacatttgatccttcagtggcccccagctggttcacatctttaacatctcttgcttctgtgtgagttatccaaaacttttggaattttaaattttgtgtcgtcttgtgatgacaatttcatactcatctctatatgttttgatcactcagttcaatagtttctggaagtctttctggccaggtcccaaaggggctcttcacattgcccacactgcagcaagtgtaattttctggtaacttacaactcaacatataagctttaaaaaaaagtgtcttatctctgcctattttgtggccaatcggacagtgtgctgagcaacaaccaattcaacgggacacttgaaattacaggcaacatcagcagctcactgcagacagtaaatctcatggacaaccgaatagtttctaccgatactgcaagctacaagaaaactctactgtaagaacctgcaaactcaataagaaccaagaacaccatacaatcttcgtcttctctcctacctttcaccaacattgcctcacttctcatgccatatcctgtctgcagcctggcaggtaatccgttttgcgccgagcaagatcccaacaacagagccttctgcagcaggcagctacagaacgcgagcccatacagtaccagtatggaaaaatgcggctcagctcagtgcagtgatggtcagaacgtgaaccctgcaagctgcggctgtgctttctcatacaacggcaagatggttttcagggcacccttcttcgtcgacttggtgagcagtacgccgttccagctgctggagtcgaccatggcggcaaagctgaacctgctccctggctcggtcgctctctcagacatccacttcaacagtgacaactacctccaagttcaagtgaagctgttcccaacatccggggtgaccttcaacctgtcagaattgacaaggattggttcttctctcagtaaccagatttacaaaccaccagcaaattttggaccttatttcttcattgcagacccatatgcccccttggcaggtacttggatttcactgtgtcgagactcccactttatttgcactgaagtagttttagttttccctttgagaatgcagaggtatcaaaattacagcttaggaaataccacatttcgttatctgagggttggtatcttgaaagttttaattttttacttctaaattgcaattaatgagatgctaaaaggactctgctattttatgtcggagagtttagtatttgcacaaaagtactagtatatagtggtgtgaggattgctcactctgattttgtgtgtgccagttgctcttggtggcaaaaaatccaagatgagcacaggtgccatagctggaattgcagtagccggtggggtccttgttatcgccctcattttcatgtcattgtttgctctccgacagaagagaagggctaaggaactcaaggaaagagcagacccttttggtaaggatctaaaagctcataggtatcatgtcactgcaatgccaccaagcaatttgtcagggacacattaacagctacaagcagcagcatcctactgcatgctactactggaataaactgacaagatcaagaagttctgaaacaactgaacctgttttctgatccaaaattttcagcttcatgggctgctggccagaaggacagtggaggggctccacagctgaagggagcaaggttcttctcctttgacgagctcaagatctgcaccaacaacttctctgacaaccacgagatcgggtcaggaggctacgggaaggtgtacagagggattctcggtgacggaacccgtgtcgccatcaagcgtgcagaccgcaactcaatgcagggcgctgtggagttcaagaacgagatcgagctgctgtccagggtgcaccaccgcaacctggtcagcctcattggcttctgctacgagcaaggtgaacagatgctcgtctacgagtacatctccaatggcacactcagagagaacttgacgggtaaatccacatcccataattaacattgccatgaatctgattacacattttatttcgccatttcgtttgcattgctaaaatgattcttttatcaaatgttaactgaaaaggttttgatttgcaggaagtgggatgtacttggactggaagaagaggctgaggatcgcgcttggctcggccagagggcttgcctacctgcacgagctcgctgacccaccgatcatccaccgcgacatcaagtccaccaacatcctcctcgacaacaacctcaaggccaaggttgccgacttcgggctctccaagctcgtggccgacactgagaagggccatgtctccacccaagtcaagggaacactggtaaattcccctcactatccgctcatgccaatctcctgacagaactgaattttgagcctcacttcagtactcactaataaaaatctactaacatcttgagaaccaatcaaaatcgatatgcttaatttgaaatcaaacttgaagtaaatatggtaactaagcatgtacccattgcacttcaccttactaaccacttctcccaatctcaaaataaatcgataaaattcaccttactaaccacttcttccaatctcatgacaaattgataaaattcaccctactaaccacttctgcaagtctcctgacataactgaacttttaggttcgcttcagtaaaattcgacgaacatcttgaggaccaattgaaatagatatgcttaatttgatctgatagtataaagaaaacaatcaagattgaaacaaatggtaataaaatcgatgggatgtggctagggctacctggacccggagtactacatgacgcagcagctgtcggagaagagcgacgtgtacagcttcggggtggtgatgctggagctggtgagcgggaggcagccgatcgagaaggggcggtacgtggtgcgggaggtgcggctggccatcgacccggccgaccacgaccaccactacggcctccgcgggatcgtcgacccggccatccgcgacgccgcgcgcaccccggtgttccggcggttcgtgcagctggcgatgcggtgcgtcgacgagtcggcggcggcgcgcccggccatgggcgccgtggtgaaggagatcgaggccatgctgcagaacgagcccgacgacgccggcgccggggagggggacagctccgccgacccgtccgccaacgagttcgaccgccaccgcggcggtggcggcccgccggcgcacccctacagcgacgtggagatcagccggggatcgtacgccggcgatggcgcgtcggattacatgccctattttgaggtcaagcccaagtagtcatcattagattgtaaattgatgagggtgttgtttgtttcagtttttttttcctttgttctttctccttttcagcttgtgatgaattgtaaattttgtatgtgttgcgagttgcgacagattaatatatactgctacagattctttc</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0486100, RefSeq:Os05g0486100

  1. 1.0 1.1 Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  3. Cite error: Invalid <ref> tag; no text was provided for refs named ref3