Difference between revisions of "Os09g0327600"
| Line 1: | Line 1: | ||
Rice blast, caused by the fungus ''Magnaporthe oryzae'', is one of the most devastating diseases of rice. To understand the molecular basis of Pi5-mediated resistance to ''M. oryzae'', we cloned the resistance (R) gene at this locus using a map-based cloning strategy. Genetic and phenotypic analyses of 2014 F2 progeny from a mapping population derived from a cross between IR50, a susceptible rice cultivar, and the RIL260 line carrying Pi5 enabled us to narrow down the Pi5 locus to a 130-kb interval. Sequence analysis of this genomic region identified two candidate genes, Pi5-1 and Pi5-2, which encode proteins carrying three motifs characteristic of R genes: an N-terminal coiled-coil (CC) motif, a nucleotide-binding (NB) domain, and a leucine-rich repeat (LRR) motif. In genetic transformation experiments of a susceptible rice cultivar, neither the Pi5-1 nor the Pi5-2 gene was found to confer resistance to ''M. oryzae''. In contrast, transgenic rice plants expressing both of these genes, generated by crossing transgenic lines carrying each gene individually, conferred Pi5-mediated resistance to ''M. oryzae''. Gene expression analysis revealed that Pi5-1 transcripts accumulate after pathogen challenge, whereas the Pi5-2 gene is constitutively expressed. These results indicate that the presence of these two genes is required for rice Pi5-mediated resistance to ''M. oryzae''. | Rice blast, caused by the fungus ''Magnaporthe oryzae'', is one of the most devastating diseases of rice. To understand the molecular basis of Pi5-mediated resistance to ''M. oryzae'', we cloned the resistance (R) gene at this locus using a map-based cloning strategy. Genetic and phenotypic analyses of 2014 F2 progeny from a mapping population derived from a cross between IR50, a susceptible rice cultivar, and the RIL260 line carrying Pi5 enabled us to narrow down the Pi5 locus to a 130-kb interval. Sequence analysis of this genomic region identified two candidate genes, Pi5-1 and Pi5-2, which encode proteins carrying three motifs characteristic of R genes: an N-terminal coiled-coil (CC) motif, a nucleotide-binding (NB) domain, and a leucine-rich repeat (LRR) motif. In genetic transformation experiments of a susceptible rice cultivar, neither the Pi5-1 nor the Pi5-2 gene was found to confer resistance to ''M. oryzae''. In contrast, transgenic rice plants expressing both of these genes, generated by crossing transgenic lines carrying each gene individually, conferred Pi5-mediated resistance to ''M. oryzae''. Gene expression analysis revealed that Pi5-1 transcripts accumulate after pathogen challenge, whereas the Pi5-2 gene is constitutively expressed. These results indicate that the presence of these two genes is required for rice Pi5-mediated resistance to ''M. oryzae''. | ||
[[File:1.jpg]] | [[File:1.jpg]] | ||
| + | ==References== | ||
| + | <references> | ||
| + | <ref name="ref1"> | ||
| + | S.Fukuoka;K.Okuno QTL analysis and mapping of pi21, a recessive gene for field resistance to rice blast in Japanese upland rice Theoretical and Applied Genetics, 2001, 103(2-3): 185-190 | ||
| + | </ref> | ||
| + | <ref name="ref2"> | ||
| + | Shuichi Fukuoka;Norikuni Saka;Hironori Koga;Kazuko Ono;Takehiko Shimizu;Kaworu Ebana;Nagao Hayashi;Akira Takahashi;Hirohiko Hirochika;Kazutoshi Okuno;Masahiro Yano Loss of Function of a Proline-Containing Protein Confers Durable Disease Resistance in Rice Science, 2009, 325(5943): 998-1001 | ||
| + | </ref> | ||
| + | </references> | ||
| + | |||
| + | ==Structured Information== | ||
| + | {{JaponicaGene| | ||
| + | GeneName = Os04g0401000| | ||
| + | Description = Heavy metal transport/detoxification protein domain containing protein| | ||
| + | Version = NM_001059220.1 GI:115458169 GeneID:4335725| | ||
| + | Length = 1679 bp| | ||
| + | Definition = Oryza sativa Japonica Group Os04g0401000, complete gene.| | ||
| + | Source = Oryza sativa Japonica Group | ||
| + | |||
| + | ORGANISM Oryza sativa Japonica Group | ||
| + | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; | ||
| + | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP | ||
| + | clade; Ehrhartoideae; Oryzeae; Oryza. | ||
| + | | | ||
| + | Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]| | ||
| + | AP = Chromosome 4:19856181..19857859| | ||
| + | CDS = 19856474..19856539,19856708..19857192,19857329..19857410| | ||
| + | GCID = <gbrowseImage1> | ||
| + | name=NC_008397:19856181..19857859 | ||
| + | source=RiceChromosome04 | ||
| + | preset=GeneLocation | ||
| + | </gbrowseImage1>| | ||
| + | GSID = <gbrowseImage2> | ||
| + | name=NC_008397:19856181..19857859 | ||
| + | source=RiceChromosome04 | ||
| + | preset=GeneLocation | ||
| + | </gbrowseImage2>| | ||
| + | CDNA = <cdnaseq>atgggtatattggtcatcttggtggacctgcaatgctgccgctgcgatgccaagatcaggaaggtcctgggctgccttgaagaggagtactgcatcgagaaggtggagtacgacgtgaagaacaacagggtgatcgtgcgcgggaagttcgacccggagaagctgtgcaagaagatctggtgcaaggccggcaagatcatcaaggagatcctcatcgtcgacgtctggccgccgccgctgccgcagccgccgccgccgtgcaagccgccgccgtgcgagaagcctccggaggactgcaagcccaagccctgccattgctgcagctgcgagaagcccaagcccaagcccaagccctgccactgcgagaagcccaagccctgtcactgcgagaagcccaagccatgcgagaagccgccgccgtgcaagccggaggagccgccgaagccgccgccggagaagccgccgccgaagccggagtgcaagctggtgccgtacccttacccggtgccgtacccgtacgccgggcagtggtgctgcccaaagcctgagccgccgaagccgccgccgcccgtctgcccgccgccgccgtggtgctacaccgaggacaacgccaacgcctgctccatcatgtga</cdnaseq>| | ||
| + | AA = <aaseq>MGILVILVDLQCCRCDAKIRKVLGCLEEEYCIEKVEYDVKNNRV IVRGKFDPEKLCKKIWCKAGKIIKEILIVDVWPPPLPQPPPPCKPPPCEKPPEDCKPK PCHCCSCEKPKPKPKPCHCEKPKPCHCEKPKPCEKPPPCKPEEPPKPPPEKPPPKPEC KLVPYPYPVPYPYAGQWCCPKPEPPKPPPPVCPPPPWCYTEDNANACSIM</aaseq>| | ||
| + | DNA = <dnaseqindica>1321..1386#668..1152#450..531#atgcatcgcctccattattcatgcttcgattctccatgctttcctctactgctcattggtaacattcggcaaatttgacaggtgagctcagtattttaaatcttaatgtagtactttggtgtgctaatctttgctctgttcaaaagagaattctggtttctttgctattttgaaaagagaattttcgttacaggacttcaacttccataatacttttttttataattaaggcatgatatatatcttctttctgaattccacgggaattgcactttttcctgagaaatttgtaaagagcatgcctgttaattgcaaggggcccctaactctgttatgagaaaagagaactatataagatgctcaataagcacctctttttttttttctgttaactgaccaaagcctgtctatctgcatttttttttgttttttgtttttcttgtgtgcagatgggtatattggtcatcttggtggacctgcaatgctgccgctgcgatgccaagatcaggaaggtcctgggctgccttgaaggtataataaattctgcccgaatcgtccatgtttgattgaattttcaaggctaatcagcagtgttcctgctcaattgggagcaaaacctctgttaaaaagggtgtgtttgaatgaatataattgaatatgaacgcagaggagtactgcatcgagaaggtggagtacgacgtgaagaacaacagggtgatcgtgcgcgggaagttcgacccggagaagctgtgcaagaagatctggtgcaaggccggcaagatcatcaaggagatcctcatcgtcgacgtctggccgccgccgctgccgcagccgccgccgccgtgcaagccgccgccgtgcgagaagcctccggaggactgcaagcccaagccctgccattgctgcagctgcgagaagcccaagcccaagcccaagccctgccactgcgagaagcccaagccctgtcactgcgagaagcccaagccatgcgagaagccgccgccgtgcaagccggaggagccgccgaagccgccgccggagaagccgccgccgaagccggagtgcaagctggtgccgtacccttacccggtgccgtacccgtacgccgggcagtggtgctgcccaaagcctgagccgccgaagccgccgccggagccaccgaaggagccggagccgccgaagccgtgcgggtgctcgcacgccttcgtgtgcgtctgcaagccggcgccgccgccgccgccgccgtgcgggtgctcggggggccacgggaactgcggctgcggcatcaggccgtggccgccgcaggtgtggccgccgccgcccgtctgcccgccgccgccgtggtgctacaccgaggacaacgccaacgcctgctccatcatgtgatggccggccggcggtcggcgtcgatcacgatcatctctgctgcttaatttccttgcttgctactacctctgctcctttccttgcctcggaaatcggaataaattaaacacgaggctgatcgatgtgtttgtaattaatccatggtgtttgtgttgtgtgctgtgtgggctgtataataattaattacagtatgttcatgtaaatttgtttgtttgtttgtttatgttgttcgatatgtataattatgtacaataattaatcgtggagaggctcactaaactcataaactgtag</dnaseqindica>| | ||
| + | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001059220.1 RefSeq:Os04g0401000]| | ||
| + | }} | ||
| + | [[Category:Genes]] | ||
| + | [[Category:Japonica mRNA]] | ||
| + | [[Category:Oryza Sativa Japonica Group]] | ||
| + | [[Category:Japonica Genes]] | ||
| + | [[Category:Japonica Chromosome 4]] | ||
| + | [[Category:Chromosome 4]] | ||
Revision as of 01:27, 27 May 2014
Rice blast, caused by the fungus Magnaporthe oryzae, is one of the most devastating diseases of rice. To understand the molecular basis of Pi5-mediated resistance to M. oryzae, we cloned the resistance (R) gene at this locus using a map-based cloning strategy. Genetic and phenotypic analyses of 2014 F2 progeny from a mapping population derived from a cross between IR50, a susceptible rice cultivar, and the RIL260 line carrying Pi5 enabled us to narrow down the Pi5 locus to a 130-kb interval. Sequence analysis of this genomic region identified two candidate genes, Pi5-1 and Pi5-2, which encode proteins carrying three motifs characteristic of R genes: an N-terminal coiled-coil (CC) motif, a nucleotide-binding (NB) domain, and a leucine-rich repeat (LRR) motif. In genetic transformation experiments of a susceptible rice cultivar, neither the Pi5-1 nor the Pi5-2 gene was found to confer resistance to M. oryzae. In contrast, transgenic rice plants expressing both of these genes, generated by crossing transgenic lines carrying each gene individually, conferred Pi5-mediated resistance to M. oryzae. Gene expression analysis revealed that Pi5-1 transcripts accumulate after pathogen challenge, whereas the Pi5-2 gene is constitutively expressed. These results indicate that the presence of these two genes is required for rice Pi5-mediated resistance to M. oryzae.
References
Cite error: <ref> tag defined in <references> has group attribute "" which does not appear in prior text.
Cite error: <ref> tag defined in <references> has group attribute "" which does not appear in prior text.
Structured Information
| Gene Name |
Os04g0401000 |
|---|---|
| Description |
Heavy metal transport/detoxification protein domain containing protein |
| Version |
NM_001059220.1 GI:115458169 GeneID:4335725 |
| Length |
1679 bp |
| Definition |
Oryza sativa Japonica Group Os04g0401000, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 4:19856181..19857859 |
| Sequence Coding Region |
19856474..19856539,19856708..19857192,19857329..19857410 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008397:19856181..19857859 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008397:19856181..19857859 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgggtatattggtcatcttggtggacctgcaatgctgccgctgcgatgccaagatcaggaaggtcctgggctgccttgaagaggagtactgcatcgagaaggtggagtacgacgtgaagaacaacagggtgatcgtgcgcgggaagttcgacccggagaagctgtgcaagaagatctggtgcaaggccggcaagatcatcaaggagatcctcatcgtcgacgtctggccgccgccgctgccgcagccgccgccgccgtgcaagccgccgccgtgcgagaagcctccggaggactgcaagcccaagccctgccattgctgcagctgcgagaagcccaagcccaagcccaagccctgccactgcgagaagcccaagccctgtcactgcgagaagcccaagccatgcgagaagccgccgccgtgcaagccggaggagccgccgaagccgccgccggagaagccgccgccgaagccggagtgcaagctggtgccgtacccttacccggtgccgtacccgtacgccgggcagtggtgctgcccaaagcctgagccgccgaagccgccgccgcccgtctgcccgccgccgccgtggtgctacaccgaggacaacgccaacgcctgctccatcatgtga</cdnaseq> |
| Protein Sequence |
<aaseq>MGILVILVDLQCCRCDAKIRKVLGCLEEEYCIEKVEYDVKNNRV IVRGKFDPEKLCKKIWCKAGKIIKEILIVDVWPPPLPQPPPPCKPPPCEKPPEDCKPK PCHCCSCEKPKPKPKPCHCEKPKPCHCEKPKPCEKPPPCKPEEPPKPPPEKPPPKPEC KLVPYPYPVPYPYAGQWCCPKPEPPKPPPPVCPPPPWCYTEDNANACSIM</aaseq> |
| Gene Sequence |
<dnaseqindica>1321..1386#668..1152#450..531#atgcatcgcctccattattcatgcttcgattctccatgctttcctctactgctcattggtaacattcggcaaatttgacaggtgagctcagtattttaaatcttaatgtagtactttggtgtgctaatctttgctctgttcaaaagagaattctggtttctttgctattttgaaaagagaattttcgttacaggacttcaacttccataatacttttttttataattaaggcatgatatatatcttctttctgaattccacgggaattgcactttttcctgagaaatttgtaaagagcatgcctgttaattgcaaggggcccctaactctgttatgagaaaagagaactatataagatgctcaataagcacctctttttttttttctgttaactgaccaaagcctgtctatctgcatttttttttgttttttgtttttcttgtgtgcagatgggtatattggtcatcttggtggacctgcaatgctgccgctgcgatgccaagatcaggaaggtcctgggctgccttgaaggtataataaattctgcccgaatcgtccatgtttgattgaattttcaaggctaatcagcagtgttcctgctcaattgggagcaaaacctctgttaaaaagggtgtgtttgaatgaatataattgaatatgaacgcagaggagtactgcatcgagaaggtggagtacgacgtgaagaacaacagggtgatcgtgcgcgggaagttcgacccggagaagctgtgcaagaagatctggtgcaaggccggcaagatcatcaaggagatcctcatcgtcgacgtctggccgccgccgctgccgcagccgccgccgccgtgcaagccgccgccgtgcgagaagcctccggaggactgcaagcccaagccctgccattgctgcagctgcgagaagcccaagcccaagcccaagccctgccactgcgagaagcccaagccctgtcactgcgagaagcccaagccatgcgagaagccgccgccgtgcaagccggaggagccgccgaagccgccgccggagaagccgccgccgaagccggagtgcaagctggtgccgtacccttacccggtgccgtacccgtacgccgggcagtggtgctgcccaaagcctgagccgccgaagccgccgccggagccaccgaaggagccggagccgccgaagccgtgcgggtgctcgcacgccttcgtgtgcgtctgcaagccggcgccgccgccgccgccgccgtgcgggtgctcggggggccacgggaactgcggctgcggcatcaggccgtggccgccgcaggtgtggccgccgccgcccgtctgcccgccgccgccgtggtgctacaccgaggacaacgccaacgcctgctccatcatgtgatggccggccggcggtcggcgtcgatcacgatcatctctgctgcttaatttccttgcttgctactacctctgctcctttccttgcctcggaaatcggaataaattaaacacgaggctgatcgatgtgtttgtaattaatccatggtgtttgtgttgtgtgctgtgtgggctgtataataattaattacagtatgttcatgtaaatttgtttgtttgtttgtttatgttgttcgatatgtataattatgtacaataattaatcgtggagaggctcactaaactcataaactgtag</dnaseqindica> |
| External Link(s) |
