Difference between revisions of "Os09g0327600"

From RiceWiki
Jump to: navigation, search
Line 1: Line 1:
 
   Rice blast, caused by the fungus ''Magnaporthe oryzae'', is one of the most devastating diseases of rice. To understand the molecular basis of Pi5-mediated resistance to ''M. oryzae'', we cloned the resistance (R) gene at this locus using a map-based cloning strategy. Genetic and phenotypic analyses of 2014 F2 progeny from a mapping population derived from a cross between IR50, a susceptible rice cultivar, and the RIL260 line carrying Pi5 enabled us to narrow down the Pi5 locus to a 130-kb interval. Sequence analysis of this genomic region identified two candidate genes, Pi5-1 and Pi5-2, which encode proteins carrying three motifs characteristic of R genes: an N-terminal coiled-coil (CC) motif, a nucleotide-binding (NB) domain, and a leucine-rich repeat (LRR) motif. In genetic transformation experiments of a susceptible rice cultivar, neither the Pi5-1 nor the Pi5-2 gene was found to confer resistance to ''M. oryzae''. In contrast, transgenic rice plants expressing both of these genes, generated by crossing transgenic lines carrying each gene individually, conferred Pi5-mediated resistance to ''M. oryzae''. Gene expression analysis revealed that Pi5-1 transcripts accumulate after pathogen challenge, whereas the Pi5-2 gene is constitutively expressed. These results indicate that the presence of these two genes is required for rice Pi5-mediated resistance to ''M. oryzae''.
 
   Rice blast, caused by the fungus ''Magnaporthe oryzae'', is one of the most devastating diseases of rice. To understand the molecular basis of Pi5-mediated resistance to ''M. oryzae'', we cloned the resistance (R) gene at this locus using a map-based cloning strategy. Genetic and phenotypic analyses of 2014 F2 progeny from a mapping population derived from a cross between IR50, a susceptible rice cultivar, and the RIL260 line carrying Pi5 enabled us to narrow down the Pi5 locus to a 130-kb interval. Sequence analysis of this genomic region identified two candidate genes, Pi5-1 and Pi5-2, which encode proteins carrying three motifs characteristic of R genes: an N-terminal coiled-coil (CC) motif, a nucleotide-binding (NB) domain, and a leucine-rich repeat (LRR) motif. In genetic transformation experiments of a susceptible rice cultivar, neither the Pi5-1 nor the Pi5-2 gene was found to confer resistance to ''M. oryzae''. In contrast, transgenic rice plants expressing both of these genes, generated by crossing transgenic lines carrying each gene individually, conferred Pi5-mediated resistance to ''M. oryzae''. Gene expression analysis revealed that Pi5-1 transcripts accumulate after pathogen challenge, whereas the Pi5-2 gene is constitutively expressed. These results indicate that the presence of these two genes is required for rice Pi5-mediated resistance to ''M. oryzae''.
 
[[File:1.jpg]]
 
[[File:1.jpg]]
 +
==References==
 +
<references>
 +
<ref name="ref1">
 +
S.Fukuoka;K.Okuno QTL analysis and mapping of pi21, a recessive gene for field resistance to rice blast in Japanese upland rice Theoretical and Applied Genetics, 2001, 103(2-3): 185-190
 +
</ref>
 +
<ref name="ref2">
 +
Shuichi Fukuoka;Norikuni Saka;Hironori Koga;Kazuko Ono;Takehiko Shimizu;Kaworu Ebana;Nagao Hayashi;Akira Takahashi;Hirohiko Hirochika;Kazutoshi Okuno;Masahiro Yano Loss of Function of a Proline-Containing Protein Confers Durable Disease Resistance in Rice Science, 2009, 325(5943): 998-1001
 +
</ref>
 +
</references>
 +
 +
==Structured Information==
 +
{{JaponicaGene|
 +
GeneName = Os04g0401000|
 +
Description = Heavy metal transport/detoxification protein domain containing protein|
 +
Version = NM_001059220.1 GI:115458169 GeneID:4335725|
 +
Length = 1679 bp|
 +
Definition = Oryza sativa Japonica Group Os04g0401000, complete gene.|
 +
Source = Oryza sativa Japonica Group
 +
 +
  ORGANISM  Oryza sativa Japonica Group
 +
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 +
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 +
            clade; Ehrhartoideae; Oryzeae; Oryza.
 +
|
 +
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|
 +
AP = Chromosome 4:19856181..19857859|
 +
CDS = 19856474..19856539,19856708..19857192,19857329..19857410|
 +
GCID = <gbrowseImage1>
 +
name=NC_008397:19856181..19857859
 +
source=RiceChromosome04
 +
preset=GeneLocation
 +
</gbrowseImage1>|
 +
GSID = <gbrowseImage2>
 +
name=NC_008397:19856181..19857859
 +
source=RiceChromosome04
 +
preset=GeneLocation
 +
</gbrowseImage2>|
 +
CDNA = <cdnaseq>atgggtatattggtcatcttggtggacctgcaatgctgccgctgcgatgccaagatcaggaaggtcctgggctgccttgaagaggagtactgcatcgagaaggtggagtacgacgtgaagaacaacagggtgatcgtgcgcgggaagttcgacccggagaagctgtgcaagaagatctggtgcaaggccggcaagatcatcaaggagatcctcatcgtcgacgtctggccgccgccgctgccgcagccgccgccgccgtgcaagccgccgccgtgcgagaagcctccggaggactgcaagcccaagccctgccattgctgcagctgcgagaagcccaagcccaagcccaagccctgccactgcgagaagcccaagccctgtcactgcgagaagcccaagccatgcgagaagccgccgccgtgcaagccggaggagccgccgaagccgccgccggagaagccgccgccgaagccggagtgcaagctggtgccgtacccttacccggtgccgtacccgtacgccgggcagtggtgctgcccaaagcctgagccgccgaagccgccgccgcccgtctgcccgccgccgccgtggtgctacaccgaggacaacgccaacgcctgctccatcatgtga</cdnaseq>|
 +
AA = <aaseq>MGILVILVDLQCCRCDAKIRKVLGCLEEEYCIEKVEYDVKNNRV                    IVRGKFDPEKLCKKIWCKAGKIIKEILIVDVWPPPLPQPPPPCKPPPCEKPPEDCKPK                    PCHCCSCEKPKPKPKPCHCEKPKPCHCEKPKPCEKPPPCKPEEPPKPPPEKPPPKPEC                    KLVPYPYPVPYPYAGQWCCPKPEPPKPPPPVCPPPPWCYTEDNANACSIM</aaseq>|
 +
DNA = <dnaseqindica>1321..1386#668..1152#450..531#atgcatcgcctccattattcatgcttcgattctccatgctttcctctactgctcattggtaacattcggcaaatttgacaggtgagctcagtattttaaatcttaatgtagtactttggtgtgctaatctttgctctgttcaaaagagaattctggtttctttgctattttgaaaagagaattttcgttacaggacttcaacttccataatacttttttttataattaaggcatgatatatatcttctttctgaattccacgggaattgcactttttcctgagaaatttgtaaagagcatgcctgttaattgcaaggggcccctaactctgttatgagaaaagagaactatataagatgctcaataagcacctctttttttttttctgttaactgaccaaagcctgtctatctgcatttttttttgttttttgtttttcttgtgtgcagatgggtatattggtcatcttggtggacctgcaatgctgccgctgcgatgccaagatcaggaaggtcctgggctgccttgaaggtataataaattctgcccgaatcgtccatgtttgattgaattttcaaggctaatcagcagtgttcctgctcaattgggagcaaaacctctgttaaaaagggtgtgtttgaatgaatataattgaatatgaacgcagaggagtactgcatcgagaaggtggagtacgacgtgaagaacaacagggtgatcgtgcgcgggaagttcgacccggagaagctgtgcaagaagatctggtgcaaggccggcaagatcatcaaggagatcctcatcgtcgacgtctggccgccgccgctgccgcagccgccgccgccgtgcaagccgccgccgtgcgagaagcctccggaggactgcaagcccaagccctgccattgctgcagctgcgagaagcccaagcccaagcccaagccctgccactgcgagaagcccaagccctgtcactgcgagaagcccaagccatgcgagaagccgccgccgtgcaagccggaggagccgccgaagccgccgccggagaagccgccgccgaagccggagtgcaagctggtgccgtacccttacccggtgccgtacccgtacgccgggcagtggtgctgcccaaagcctgagccgccgaagccgccgccggagccaccgaaggagccggagccgccgaagccgtgcgggtgctcgcacgccttcgtgtgcgtctgcaagccggcgccgccgccgccgccgccgtgcgggtgctcggggggccacgggaactgcggctgcggcatcaggccgtggccgccgcaggtgtggccgccgccgcccgtctgcccgccgccgccgtggtgctacaccgaggacaacgccaacgcctgctccatcatgtgatggccggccggcggtcggcgtcgatcacgatcatctctgctgcttaatttccttgcttgctactacctctgctcctttccttgcctcggaaatcggaataaattaaacacgaggctgatcgatgtgtttgtaattaatccatggtgtttgtgttgtgtgctgtgtgggctgtataataattaattacagtatgttcatgtaaatttgtttgtttgtttgtttatgttgttcgatatgtataattatgtacaataattaatcgtggagaggctcactaaactcataaactgtag</dnaseqindica>|
 +
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001059220.1 RefSeq:Os04g0401000]|
 +
}}
 +
[[Category:Genes]]
 +
[[Category:Japonica mRNA]]
 +
[[Category:Oryza Sativa Japonica Group]]
 +
[[Category:Japonica Genes]]
 +
[[Category:Japonica Chromosome 4]]
 +
[[Category:Chromosome 4]]

Revision as of 01:27, 27 May 2014

  Rice blast, caused by the fungus Magnaporthe oryzae, is one of the most devastating diseases of rice. To understand the molecular basis of Pi5-mediated resistance to M. oryzae, we cloned the resistance (R) gene at this locus using a map-based cloning strategy. Genetic and phenotypic analyses of 2014 F2 progeny from a mapping population derived from a cross between IR50, a susceptible rice cultivar, and the RIL260 line carrying Pi5 enabled us to narrow down the Pi5 locus to a 130-kb interval. Sequence analysis of this genomic region identified two candidate genes, Pi5-1 and Pi5-2, which encode proteins carrying three motifs characteristic of R genes: an N-terminal coiled-coil (CC) motif, a nucleotide-binding (NB) domain, and a leucine-rich repeat (LRR) motif. In genetic transformation experiments of a susceptible rice cultivar, neither the Pi5-1 nor the Pi5-2 gene was found to confer resistance to M. oryzae. In contrast, transgenic rice plants expressing both of these genes, generated by crossing transgenic lines carrying each gene individually, conferred Pi5-mediated resistance to M. oryzae. Gene expression analysis revealed that Pi5-1 transcripts accumulate after pathogen challenge, whereas the Pi5-2 gene is constitutively expressed. These results indicate that the presence of these two genes is required for rice Pi5-mediated resistance to M. oryzae.

1.jpg

References

Cite error: <ref> tag defined in <references> has group attribute "" which does not appear in prior text.
Cite error: <ref> tag defined in <references> has group attribute "" which does not appear in prior text.

Structured Information

Gene Name

Os04g0401000

Description

Heavy metal transport/detoxification protein domain containing protein

Version

NM_001059220.1 GI:115458169 GeneID:4335725

Length

1679 bp

Definition

Oryza sativa Japonica Group Os04g0401000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:19856181..19857859

Sequence Coding Region

19856474..19856539,19856708..19857192,19857329..19857410

Expression

GEO Profiles:Os04g0401000

Genome Context

<gbrowseImage1> name=NC_008397:19856181..19857859 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:19856181..19857859 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgggtatattggtcatcttggtggacctgcaatgctgccgctgcgatgccaagatcaggaaggtcctgggctgccttgaagaggagtactgcatcgagaaggtggagtacgacgtgaagaacaacagggtgatcgtgcgcgggaagttcgacccggagaagctgtgcaagaagatctggtgcaaggccggcaagatcatcaaggagatcctcatcgtcgacgtctggccgccgccgctgccgcagccgccgccgccgtgcaagccgccgccgtgcgagaagcctccggaggactgcaagcccaagccctgccattgctgcagctgcgagaagcccaagcccaagcccaagccctgccactgcgagaagcccaagccctgtcactgcgagaagcccaagccatgcgagaagccgccgccgtgcaagccggaggagccgccgaagccgccgccggagaagccgccgccgaagccggagtgcaagctggtgccgtacccttacccggtgccgtacccgtacgccgggcagtggtgctgcccaaagcctgagccgccgaagccgccgccgcccgtctgcccgccgccgccgtggtgctacaccgaggacaacgccaacgcctgctccatcatgtga</cdnaseq>

Protein Sequence

<aaseq>MGILVILVDLQCCRCDAKIRKVLGCLEEEYCIEKVEYDVKNNRV IVRGKFDPEKLCKKIWCKAGKIIKEILIVDVWPPPLPQPPPPCKPPPCEKPPEDCKPK PCHCCSCEKPKPKPKPCHCEKPKPCHCEKPKPCEKPPPCKPEEPPKPPPEKPPPKPEC KLVPYPYPVPYPYAGQWCCPKPEPPKPPPPVCPPPPWCYTEDNANACSIM</aaseq>

Gene Sequence

<dnaseqindica>1321..1386#668..1152#450..531#atgcatcgcctccattattcatgcttcgattctccatgctttcctctactgctcattggtaacattcggcaaatttgacaggtgagctcagtattttaaatcttaatgtagtactttggtgtgctaatctttgctctgttcaaaagagaattctggtttctttgctattttgaaaagagaattttcgttacaggacttcaacttccataatacttttttttataattaaggcatgatatatatcttctttctgaattccacgggaattgcactttttcctgagaaatttgtaaagagcatgcctgttaattgcaaggggcccctaactctgttatgagaaaagagaactatataagatgctcaataagcacctctttttttttttctgttaactgaccaaagcctgtctatctgcatttttttttgttttttgtttttcttgtgtgcagatgggtatattggtcatcttggtggacctgcaatgctgccgctgcgatgccaagatcaggaaggtcctgggctgccttgaaggtataataaattctgcccgaatcgtccatgtttgattgaattttcaaggctaatcagcagtgttcctgctcaattgggagcaaaacctctgttaaaaagggtgtgtttgaatgaatataattgaatatgaacgcagaggagtactgcatcgagaaggtggagtacgacgtgaagaacaacagggtgatcgtgcgcgggaagttcgacccggagaagctgtgcaagaagatctggtgcaaggccggcaagatcatcaaggagatcctcatcgtcgacgtctggccgccgccgctgccgcagccgccgccgccgtgcaagccgccgccgtgcgagaagcctccggaggactgcaagcccaagccctgccattgctgcagctgcgagaagcccaagcccaagcccaagccctgccactgcgagaagcccaagccctgtcactgcgagaagcccaagccatgcgagaagccgccgccgtgcaagccggaggagccgccgaagccgccgccggagaagccgccgccgaagccggagtgcaagctggtgccgtacccttacccggtgccgtacccgtacgccgggcagtggtgctgcccaaagcctgagccgccgaagccgccgccggagccaccgaaggagccggagccgccgaagccgtgcgggtgctcgcacgccttcgtgtgcgtctgcaagccggcgccgccgccgccgccgccgtgcgggtgctcggggggccacgggaactgcggctgcggcatcaggccgtggccgccgcaggtgtggccgccgccgcccgtctgcccgccgccgccgtggtgctacaccgaggacaacgccaacgcctgctccatcatgtgatggccggccggcggtcggcgtcgatcacgatcatctctgctgcttaatttccttgcttgctactacctctgctcctttccttgcctcggaaatcggaataaattaaacacgaggctgatcgatgtgtttgtaattaatccatggtgtttgtgttgtgtgctgtgtgggctgtataataattaattacagtatgttcatgtaaatttgtttgtttgtttgtttatgttgttcgatatgtataattatgtacaataattaatcgtggagaggctcactaaactcataaactgtag</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0401000, RefSeq:Os04g0401000