Difference between revisions of "Os05g0429900"

From RiceWiki
Jump to: navigation, search
(Expression)
(Labs working on this gene)
Line 14: Line 14:
  
 
==Labs working on this gene==
 
==Labs working on this gene==
 +
Key Laboratory for Crop Germplasm Innovation and Utilization of Hunan Province, Hunan Agricultural University, Changsha, China
 +
College of Bioscience and Biotechnology, Hunan Agricultural University, Changsha, China
 +
Center of Analysis and Testing, Hunan Agricultural University, Changsha, China
  
 
==References==
 
==References==

Revision as of 07:16, 25 May 2014

Please input one-sentence summary here.

Annotated Information

Function

This gene may principally play roles in early heat response in rice.

Expression

MYBS3 activated cold signaling pathway in rice. Some research showed that, among 27 HR Myb genes, 17 genes were early activated, two (Os02g0624300 and Os05g0429900)were continuously up-regulated.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Key Laboratory for Crop Germplasm Innovation and Utilization of Hunan Province, Hunan Agricultural University, Changsha, China College of Bioscience and Biotechnology, Hunan Agricultural University, Changsha, China Center of Analysis and Testing, Hunan Agricultural University, Changsha, China

References

Chang-Jie Jiang,1 Masaki Shimono,1 Satoru Maeda,1 Haruhiko Inoue,1 Masaki Mori,1Morifumi Hasegawa,2 Shoji Sugano,1 and Hiroshi Takatsuji1.Suppression of the Rice Fatty-Acid Desaturase Gene OsSSI2 Enhances Resistance to Blast and Leaf Blight Diseases in Rice.MPMI 2009,22(7): 820–829.

Hui-Yuan Ya, Qiu-Fang Chen, Wei-Dong Wang, Guang-Yong Qin, and Zhen Jiao.Pathway Analysis of the Differentially Expressed Genes in Oryza Sativa Exposed to the Implantation of Low-Energy Nitrogen Ion.International Journal of Bioscience, Biochemistry and Bioinformatics, 2011,1( 2 ):89-97.

Liebo Shu1, Qiaojun Lou, Chenfei Ma, Wei Ding, Jia Zhou, Jinhong Wu, Fangjun Feng,Xin Lu, Lijun Luo, Guowang Xu� and Hanwei Mei.Genetic, proteomic and metabolic analysis of the regulation of energy storage in rice seedlings in response to drought.Proteomics 2011, 11: 4122–4138.

Structured Information

Gene Name

Os05g0429900

Description

Similar to MybHv5 (Fragment)

Version

NM_001187510.1 GI:297724150 GeneID:9266213

Length

1279 bp

Definition

Oryza sativa Japonica Group Os05g0429900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:21106104..21107382

Sequence Coding Region

21106375..21106894,21106995..21107257

Expression

GEO Profiles:Os05g0429900

Genome Context

<gbrowseImage1> name=NC_008398:21106104..21107382 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:21106104..21107382 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggggaggtcgccgtgctgcgagaaggcgcacacgaacaagggggcgtggacgaaggaggaggaccagcggctcatcgcgtacatcagggcgcatggcgaaggctgctggcgctcgctgcccaaggcggcgggcctccttcgctgcggcaagagctgccgcctccggtggatgaactacctccgccccgacctcaagcgcggcaacttcaccgacgacgaggacgagctcatcatccgcctccacagcctcctcggcaacaagtggtctctgatcgccgggcagctgccggggaggacggacaacgagatcaagaactactggaacacgcacatcaagcgcaagctcctcgcccgcggcatcgacccgcagacgcaccgcccgctgctcagcggcggtgacggcatcgcggcgagcaacaaggcggcaccaccgccgccgcatcccatatccgtcccggcgaaggcggcggccgcggcgatcttcgccgtggcgaagccgccgccgccgccgcgcccggtcgactcctcggacgacggctgccgcagcagcagcggcacaacgagcacgggggagccgcggtgccccgacctcaacctcgagctctcggtcgggccgacgccgagctcgccgccggcggagacgcccaccagcgcgcggccggtctgcctctgctaccacctcggcttccgcggcggggaggcgtgcagctgtcaggctgacagcaagggcccacacgagtttagatatttcaggccgttggaacaaggccagtacatatga</cdnaseq>

Protein Sequence

<aaseq>MGRSPCCEKAHTNKGAWTKEEDQRLIAYIRAHGEGCWRSLPKAA GLLRCGKSCRLRWMNYLRPDLKRGNFTDDEDELIIRLHSLLGNKWSLIAGQLPGRTDN EIKNYWNTHIKRKLLARGIDPQTHRPLLSGGDGIAASNKAAPPPPHPISVPAKAAAAA IFAVAKPPPPPRPVDSSDDGCRSSSGTTSTGEPRCPDLNLELSVGPTPSSPPAETPTS ARPVCLCYHLGFRGGEACSCQADSKGPHEFRYFRPLEQGQYI</aaseq>

Gene Sequence

<dnaseqindica>489..1008#126..388#ccgccgcggctcacctggaaactgggcagattggacaatcgctcgagcgagctagcgagagagagcgcgagagagcgaggcggcgcgcgcggtggttgcggatttgtagcttagagcgcggggccatggggaggtcgccgtgctgcgagaaggcgcacacgaacaagggggcgtggacgaaggaggaggaccagcggctcatcgcgtacatcagggcgcatggcgaaggctgctggcgctcgctgcccaaggcggcgggcctccttcgctgcggcaagagctgccgcctccggtggatgaactacctccgccccgacctcaagcgcggcaacttcaccgacgacgaggacgagctcatcatccgcctccacagcctcctcggcaacaagtcagtctccctccccccgtctccggcgccgccgccaccgatcgatggagcattcatcaattccttgtgattctcaattcggtttcgcttcttctttcaggtggtctctgatcgccgggcagctgccggggaggacggacaacgagatcaagaactactggaacacgcacatcaagcgcaagctcctcgcccgcggcatcgacccgcagacgcaccgcccgctgctcagcggcggtgacggcatcgcggcgagcaacaaggcggcaccaccgccgccgcatcccatatccgtcccggcgaaggcggcggccgcggcgatcttcgccgtggcgaagccgccgccgccgccgcgcccggtcgactcctcggacgacggctgccgcagcagcagcggcacaacgagcacgggggagccgcggtgccccgacctcaacctcgagctctcggtcgggccgacgccgagctcgccgccggcggagacgcccaccagcgcgcggccggtctgcctctgctaccacctcggcttccgcggcggggaggcgtgcagctgtcaggctgacagcaagggcccacacgagtttagatatttcaggccgttggaacaaggccagtacatatgagatatgaccatgagatgtgagatggcttaattagcttcaattcccaacatgtgtaacacagggagtttttctagtggacgacaatactgtttaatttcagaaaaaaaaagggaaagaaaaaggttctaatctgttcatatttcttactattatccaatcttcatgatctcaatctctctctctctttattatttttctttgtagtaattaacttcatgttggttcctctaaaaaagattggtcgatgttattcagtgataaatattcctag</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0429900, RefSeq:Os05g0429900