Difference between revisions of "Os01g0880800"

From RiceWiki
Jump to: navigation, search
(Labs working on this gene)
(Expression)
Line 15: Line 15:
  
 
As mentioned above, this gene has a function of drought-resistant.By detected drought-tolerant quantitative trait loci (QTL) in an RIL population from a
 
As mentioned above, this gene has a function of drought-resistant.By detected drought-tolerant quantitative trait loci (QTL) in an RIL population from a
cross of the Zhenshan97 and IRAT109 rice strains,several this gene is detected by 2-DE and/or microarray and it is localized on chromosomes containing drought-resistant QTLs (Table.1.).After transcription,this is responsible will be translated into Stearoyl-ACP desaturase.
+
cross of the Zhenshan97 and IRAT109 rice strains,several this gene is detected by 2-DE and/or microarray and it is localized on chromosomes containing drought-resistant QTLs (Table.1.).After transcription,this is responsible will be translated into Stearoyl-ACP desaturase.a stearoyl-ACP desaturase gene promoter from B. napus was shown to drive GUS expression in a manner subject to temporal regulation.However, the levels of activity in the developing seeds were not greatly in excess of those in the leaf, suggesting that this promoter may not be a major contributor to seed transcript accumulation. The promoter also directed high levels of expression in a number of other specific tissues associated with TAG accumulation or with a likely requirement for high
 +
rates of membrane lipid synthesis. Potential regulatory sequences were identified within the promoter relevant to ABA induction and pollen grain expression. It would appear highly likely that the desaturase promoter is a multifunctional promoter where combinatorial mechanisms operate to generate a complex pattem of tissue-specific expression.
 
[[File:zxq3.png|200px|thumb|left|Table. 1. RNA blot analysis.]]
 
[[File:zxq3.png|200px|thumb|left|Table. 1. RNA blot analysis.]]
  

Revision as of 09:41, 25 May 2014

This gene play a role in lipid metobolic.

Annotated Information

Function

This gene encode a protein similar to stearoyl-acyl carrier protein desaturase(SAD).On the one hand,PathwayId of the Os01g0880800 include osa00061 and osa01040. The function of osa00061 is used in Fatty acid biosynthesis,and the function of osa01040 is used in Biosynthesis of unsaturated fatty acids.Their category are both included lipid metabolism.They both play a importnt role in the lipid metobolism.The biosynthesis of PUFAs is initiated by introduction of the first double bond into stearic acid (18:0) by stearoyl-acyl carrier protein desaturase(SAD). SAD genes exhibit a tissue-specific expression profile, and the encoding enzymes regulate the pools of oleic acid (18:1), a monounsaturated fatty acid .It is capable of desaturating 18:0 and contribute to the 18:1 pool . Furthermore,the salicylic acid-mediated defense signaling pathway is constitutively active, resulting in lesion formation and increased expression of the pathogenesis-related(PR) genes. On the other hand,because multiple approaches have been used to study drought-resistant genes and identify the mechanisms of drought resistance,some researches reported that this gene can also play a pole in rice drought resistance.

Expression

A genomic database search revealed that the rice genome encodes seven SACPD-like proteins that have 46 to 86% amino acid sequence identity with Arabidopsis SSI2Prediction of subcellular targeting by using the TargetP and WoLF PSORT prediction programs suggested that Os01g0919900,Os01g0880800, and Os08g0199400 are localized in the chloplast or mitochondrion, whereas the others are present in chloroplasts.These predictions are consistent with findings that FA synthesis in plants occurs mainly in plastids(Fig.1.) .

Fig. 1. RNA blot analysis.


Fig:Transcripts of OsSSI2, two OsSSI2 homologs,WRKY45, and PR1b were analyzed in wild-type (WT) and OsSSI2 mutant plants. OsSSI2 transcripts were not detected in homozygous Osssi2-Tos17 (NF7039) and OsSSI2-knockdown (kd) plants, whereas the expression of the two closest homologs of OsSSI2 (i.e., Os04g0379900 and Os01g0880800) was unaffected in these plants. The arrow indicates a band of fusion transcripts encoding OsSSI2 with the Tos17 insertion. The salicylic acid/benzothiadiazole-induced gene WRKY45 and the pathogenesis-related gene OsPR1b were constitutively expressed in the NF7039 and OsSSI2-kd plants. Leaf blades from the fourth leaves of seedlings were used.

As mentioned above, this gene has a function of drought-resistant.By detected drought-tolerant quantitative trait loci (QTL) in an RIL population from a cross of the Zhenshan97 and IRAT109 rice strains,several this gene is detected by 2-DE and/or microarray and it is localized on chromosomes containing drought-resistant QTLs (Table.1.).After transcription,this is responsible will be translated into Stearoyl-ACP desaturase.a stearoyl-ACP desaturase gene promoter from B. napus was shown to drive GUS expression in a manner subject to temporal regulation.However, the levels of activity in the developing seeds were not greatly in excess of those in the leaf, suggesting that this promoter may not be a major contributor to seed transcript accumulation. The promoter also directed high levels of expression in a number of other specific tissues associated with TAG accumulation or with a likely requirement for high rates of membrane lipid synthesis. Potential regulatory sequences were identified within the promoter relevant to ABA induction and pollen grain expression. It would appear highly likely that the desaturase promoter is a multifunctional promoter where combinatorial mechanisms operate to generate a complex pattem of tissue-specific expression.

Table. 1. RNA blot analysis.

Fig:Genes that are differentially regulated during drought and that are co-localized with drought-tolerant QTLs, as identified in the RIL population using the same drought-tolerant parental line.

Evolution

Phylogenetic tree of stearoyl acyl carrier protein (ACP) fatty-acid desaturase (SACPD) family proteins in rice is displayed as Fig.2.

Fig. 2. Phylogenetic tree.

Fig:Phylogenetic tree of stearoyl acyl carrier protein (ACP) fatty-acid desaturase (SACPD) family proteins in rice, Arabidopsis, and soybean.The protein sequences were aligned with Clustal-X software and the tree was constructed using TreeView software. The Rice Annotation Project (RAP) codes and the rabidopsis Genome Initiative (AGI) codes are shown in the figure. The GenBank accession numbers for soybean proteins are as follows: GmSACPD-A, AAX86050; GmSACPD-B, AAX86049;and GmSACPD-C, ABM45911.

Labs working on this gene

Plant Disease Resistance Research Unit, Division of Plant Science, National Institute of Agrobiological Sciences, Kannondai , Tsukuba, 305-8602 Japan; College of Agriculture, Ibaraki University, Ami 300-0393, Japan; Shanghai Agrobiological Gene Center, Shanghai, P. R. China; CAS Key Laboratory of Separation Science for Analytical Chemistry, Dalian Institute of Chemical Physics, Chinese cademy of Sciences, Dalian, P. R. China; National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan, P. R. China; Department of Computer Science and Engineering, Seoul National University, Seoul, Republic of Korea; Bioinformatics Institute, Seoul National University, Seoul, Republic of Korea; Interdisciplinary Program in Bioinformatics, Seoul National University, Seoul, Republic of Korea; Department of Biomedical Sciences, Sunmoon University, Asan 336-708, Republic of Korea. Department of Molecular Plant Physiology and Biophysics (J.K., H.F., S.S., S.L., R.H., R.D.) and Department of Pharmaceutical Biology (M.K., N.S., A.F., M.J.M.), Julius-von-Sachs-Institute, University of Wuerzburg, D–97082 Wuerzburg, Germany; King Saud University, Riyadh 11451, Saudi Arabia (R.H.); and Albrecht-von-Haller-Institute for Plant Sciences, Department of Plant Biochemistry, University of Goettingen, D–37077 Goettingen, Germany (I.F.)

References

Chang-Jie Jiang,1 Masaki Shimono,1 Satoru Maeda,1 Haruhiko Inoue,1 Masaki Mori,1Morifumi Hasegawa,2 Shoji Sugano,1 and Hiroshi Takatsuji1.Suppression of the Rice Fatty-Acid Desaturase Gene OsSSI2 Enhances Resistance to Blast and Leaf Blight Diseases in Rice.MPMI 2009,22(7): 820–829.

Kyuri Jo , Hawk-Bin Kwon , Sun Kim.Time-series RNA-seq analysis package (TRAP) and its application to the analysis of rice, Oryza sativa L. ssp. Japonica, upon drought stress.Methods(2014)http://dx.doi.org/10.1016/j.ymeth.2014.02.001.

Joern Klinkenberg, Hanna Faist, Stefanie Saupe, Sophie Lambertz, Markus Krischke, Nadja Stingl,Agnes Fekete, Martin J. Mueller, Ivo Feussner, Rainer Hedrich, and Rosalia Deeken*.Two Fatty Acid Desaturases, STEAROYL-ACYL CARRIER PROTEIN D9-DESATURASE6 and FATTY ACID DESATURASE3, Are Involved in Drought and Hypoxia Stress Signaling in Arabidopsis Crown Galls.Plant Physiology,2014,164:(570-583).

Hui-Yuan Ya, Qiu-Fang Chen, Wei-Dong Wang, Guang-Yong Qin, and Zhen Jiao.Pathway Analysis of the Differentially Expressed Genes in Oryza Sativa Exposed to the Implantation of Low-Energy Nitrogen Ion.International Journal of Bioscience, Biochemistry and Bioinformatics, 2011,1( 2 ):89-97.

Liebo Shu1, Qiaojun Lou, Chenfei Ma, Wei Ding, Jia Zhou, Jinhong Wu, Fangjun Feng,Xin Lu, Lijun Luo, Guowang Xu and Hanwei Mei.Genetic, proteomic and metabolic analysis of the regulation of energy storage in rice seedlings in response to drought.Proteomics 2011, 11: 4122–4138.

Structured Information

Gene Name

Os01g0880800

Description

Similar to Acyl-[acyl-carrier-protein] desaturase, chloroplast precursor (EC 1.14.19.2) (Stearoyl-ACP desaturase)

Version

NM_001051529.1 GI:115441428 GeneID:4324844

Length

1484 bp

Definition

Oryza sativa Japonica Group Os01g0880800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:39980300..39981783

Sequence Coding Region

39980365..39980940,39981027..39981596

Expression

GEO Profiles:Os01g0880800

Genome Context

<gbrowseImage1> name=NC_008394:39980300..39981783 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:39980300..39981783 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgcaggtcgtgggaaccgtgcgtgtcagtggctgcggcgcggtggtggcgccctcgcgccggcagtgccgcgtgtccgcggcggtgctgacggccgcggagacggcgacggcgacgcggcgccgcgtgacgcactcgatgccgccggagaaggcggaggtgttccggtcgctggaagggtgggcgaggtcgtcgctgctgccgctgctcaagcccgtggaggagtgctggcagccgacggacttcctgccggactcgtcgtcggagatgttcgagcaccaggtccacgagctccgcgcgcgcgccgcggggctccccgacgagtacttcgtcgtgctggtcggggacatgattaccgaggaggcgctgccgacgtaccagaccatgatcaacacgctcgacggcgtccgcgacgagaccggcgccagcgcctgcccctgggccgtctggacgcgcacctggaccgccgaggagaaccgccacggcgacatcctcggcaagtacatgtacctctccggccgcgtcgacatgcgcatggtcgagaagaccgtccagtacctcatcggctccggcatggatccggggacggagaacaacccgtacctggggttcgtgtacaccagcttccaggagcgcgcgacggccgtgtcgcacgggaacacggcgcgcctcgccagggcgcacggggacgacgtcctggcgcgcacctgcggcaccatcgccgccgacgagaagcggcacgagacggcgtacgggcgcatcgtggagcagctgctgcggctcgacccggacggcgccatgctcgccatcgccgacatgatgcacaagcggatcaccatgcccgcgcacctcatgcacgacggccgcgacatgaacctgttcgaccacttcgccgccgtggcgcagcgcctcaacgtctacaccgcgcgcgactacgccgacatcgtcgagttcctcgtcaagcggtggaagctggagaccctggagactgggctctccggcgagggccggagggcccgggacttcgtgtgcgggctcgcgaagaggatgcggcgggccgcggagcgggctgaggacagggctaagaaggatgagcagaggaaggtcaagttcagctggatctatgatagggaagtgattgtctag</cdnaseq>

Protein Sequence

<aaseq>MQVVGTVRVSGCGAVVAPSRRQCRVSAAVLTAAETATATRRRVT HSMPPEKAEVFRSLEGWARSSLLPLLKPVEECWQPTDFLPDSSSEMFEHQVHELRARA AGLPDEYFVVLVGDMITEEALPTYQTMINTLDGVRDETGASACPWAVWTRTWTAEENR HGDILGKYMYLSGRVDMRMVEKTVQYLIGSGMDPGTENNPYLGFVYTSFQERATAVSH GNTARLARAHGDDVLARTCGTIAADEKRHETAYGRIVEQLLRLDPDGAMLAIADMMHK RITMPAHLMHDGRDMNLFDHFAAVAQRLNVYTARDYADIVEFLVKRWKLETLETGLSG EGRRARDFVCGLAKRMRRAAERAEDRAKKDEQRKVKFSWIYDREVIV</aaseq>

Gene Sequence

<dnaseqindica>66..641#728..1297#agaagaaatcaagaaaccaaccaccaactagctactgtagttgactgacagtgatagtggcagtcatgcaggtcgtgggaaccgtgcgtgtcagtggctgcggcgcggtggtggcgccctcgcgccggcagtgccgcgtgtccgcggcggtgctgacggccgcggagacggcgacggcgacgcggcgccgcgtgacgcactcgatgccgccggagaaggcggaggtgttccggtcgctggaagggtgggcgaggtcgtcgctgctgccgctgctcaagcccgtggaggagtgctggcagccgacggacttcctgccggactcgtcgtcggagatgttcgagcaccaggtccacgagctccgcgcgcgcgccgcggggctccccgacgagtacttcgtcgtgctggtcggggacatgattaccgaggaggcgctgccgacgtaccagaccatgatcaacacgctcgacggcgtccgcgacgagaccggcgccagcgcctgcccctgggccgtctggacgcgcacctggaccgccgaggagaaccgccacggcgacatcctcggcaagtacatgtacctctccggccgcgtcgacatgcgcatggtcgagaagaccgtccagtacctcatcggctccggcatggtacgaatctctcgaaatgttgatgccatttctctgcttggtttcaatcttttttttgcttagcattgttgctgaatccatggcaggatccggggacggagaacaacccgtacctggggttcgtgtacaccagcttccaggagcgcgcgacggccgtgtcgcacgggaacacggcgcgcctcgccagggcgcacggggacgacgtcctggcgcgcacctgcggcaccatcgccgccgacgagaagcggcacgagacggcgtacgggcgcatcgtggagcagctgctgcggctcgacccggacggcgccatgctcgccatcgccgacatgatgcacaagcggatcaccatgcccgcgcacctcatgcacgacggccgcgacatgaacctgttcgaccacttcgccgccgtggcgcagcgcctcaacgtctacaccgcgcgcgactacgccgacatcgtcgagttcctcgtcaagcggtggaagctggagaccctggagactgggctctccggcgagggccggagggcccgggacttcgtgtgcgggctcgcgaagaggatgcggcgggccgcggagcgggctgaggacagggctaagaaggatgagcagaggaaggtcaagttcagctggatctatgatagggaagtgattgtctagtttaacttgtcttggttgaattctgaattcccagtcctagatgatcatgccatttcgttatcatctctgttcttgtgttctctttgcaatgcagtaaattggtaatagttaatggtgctttgatcttggaaatttggcgttgatgtattttctggtatcattagtgaagatagtttggtttcttttc</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0880800, RefSeq:Os01g0880800