Difference between revisions of "Os07g0549600"
(→References) |
(→References) |
||
| Line 24: | Line 24: | ||
==References== | ==References== | ||
Please input cited references here. | Please input cited references here. | ||
| − | [1] Ki-Hong Jung, Min-Jung Han, Yang-Seok Lee, Yong-Woo Kim, Inhwan Hwang, Min-Jeong Kim, Yeon-Ki Kim, Baek Hie Nahm, and Gynheung An, J.(2005). RiceUndeveloped Tapetum1Is a Major Regulator of Early Tapetum Development. The Plant Cell, Vol. 17, 2705–2722 | + | [1] Ki-Hong Jung, Min-Jung Han, Yang-Seok Lee, Yong-Woo Kim, Inhwan Hwang, Min-Jeong Kim, Yeon-Ki Kim, Baek Hie Nahm, and Gynheung An, J.(2005). RiceUndeveloped Tapetum1Is a Major Regulator of Early Tapetum Development. The Plant Cell, Vol. 17, 2705–2722 [2] Solano, R., Nieto, C., Avila, J., Canas, L., Diaz, I., and Paz-Ares, J.(1995). Dual DNA binding specificity of a petal epidermis-specific MYB transcription factor (MYB.Ph3) from Petunia hybrida.EMBO J.14,1773–1784. |
| − | [2] Solano, R., Nieto, C., Avila, J., Canas, L., Diaz, I., and Paz-Ares, J.(1995). Dual DNA binding specificity of a petal epidermis-specific MYB transcription factor (MYB.Ph3) from Petunia hybrida.EMBO J.14,1773–1784. | ||
==Structured Information== | ==Structured Information== | ||
Revision as of 15:26, 25 May 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
Please input function information here. The tapetum, the innermost of four sporophytic layers in the anther wall, comes in direct contact with the developing male gametophyte and is thought to play a crucial role in the development and maturation of microspores. UDT1 gene is required for the differentiation of secondary parietal cells to mature tapetal cells and plays a major role in maintaining tapetum development, starting in early meiosis. The transcript is preferentially present in all cell types within the early anthers. This gene is a Major Regulator of Early Anther Development and at the molecular level the meiocyte development is regulated by this gene[1].
Expression
Please input expression information here. It encodes a predicted protein of 227 amino acids and the protein has an apparent molecular mass of 24.9 kD and a pI of 6.5[1]. The region between the 59th and 118th amino acids is predicted to be a bHLH domain, possessing both the HLH domain required for dimerization and a nearby basic domain necessary for target DNA binding. The promoter region comprises a putative TATA box sequence at 406 bp upstream from the start ATG codon and a CAAT box sequence at -471. The upstream region also contains putative regulatory sequences: GTGA motifs (GTGA) at -485 and -48, responsible for pollen specificity; E-box sequences (CANNTG) At - 845, - 702, and - 205, where the MYC class transcription factors bind; a MYBCORE motif (CNGTTR) at -238, in which a petunia MYB protein involved in the regulation of flavonoid biosynthesis also binds[2]; and a MYBGA motif (TAACAAA) at - 945, at which GAMYB binds.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here. National Research Laboratory of Plant Functional Genomics, Division of Molecular and Life Sciences, Pohang University of Science and Technology, Pohang 790-784, Republic of Korea Center for Plant Intracellular Trafficking and Division of Molecular and Life Sciences, Pohang University of Science and Technology, Pohang 790-784, Republic of Korea GreenGene Biotech, Myongji University 38-2, Namdong Yongin, Kyonggido 449-728, Republic of Korea Functional Genomic Center, Pohang University of Science and Technology, Pohang 790-784, Republic of Korea
References
Please input cited references here. [1] Ki-Hong Jung, Min-Jung Han, Yang-Seok Lee, Yong-Woo Kim, Inhwan Hwang, Min-Jeong Kim, Yeon-Ki Kim, Baek Hie Nahm, and Gynheung An, J.(2005). RiceUndeveloped Tapetum1Is a Major Regulator of Early Tapetum Development. The Plant Cell, Vol. 17, 2705–2722 [2] Solano, R., Nieto, C., Avila, J., Canas, L., Diaz, I., and Paz-Ares, J.(1995). Dual DNA binding specificity of a petal epidermis-specific MYB transcription factor (MYB.Ph3) from Petunia hybrida.EMBO J.14,1773–1784.
Structured Information
| Gene Name |
Os07g0549600 |
|---|---|
| Description |
Basic helix-loop-helix dimerisation region bHLH domain containing protein |
| Version |
NM_001188319.1 GI:297725768 GeneID:9269572 |
| Length |
1698 bp |
| Definition |
Oryza sativa Japonica Group Os07g0549600, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 7:22474472..22476169 |
| Sequence Coding Region |
22474473..22474668,22474893..22475089 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008400:22474472..22476169 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008400:22474472..22476169 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>gtcctgaatttcggtggaggtggtgggggagaggaggacggcgacgacggggaggaggagcagcagcagcagcaggcggcggcggcggcgatggggaaggagttcaagtccaagaacctggaggccgagcggcggaggagggggaggctcaacggcaacatcttcgcgctcagggcggtcgtgcccaagatcaccaagatgagcaaggaggccaccttgtcggacgcgatcgaacacatcaagaatctccagaacgaggttcttgagctgcagcgccagctcggcgactcacccggtgaggcttgggagaagcaatgcagcgcgtcctgctctgaatccttcgtccccactgagaacgcccattatcaggtagcagccgctgttctcaagtag</cdnaseq> |
| Protein Sequence |
<aaseq>VLNFGGGGGGEEDGDDGEEEQQQQQAAAAAMGKEFKSKNLEAER RRRGRLNGNIFALRAVVPKITKMSKEATLSDAIEHIKNLQNEVLELQRQLGDSPGEAW EKQCSASCSESFVPTENAHYQVAAAVLK</aaseq> |
| Gene Sequence |
<dnaseqindica>2..197#422..618#ggtcctgaatttcggtggaggtggtgggggagaggaggacggcgacgacggggaggaggagcagcagcagcagcaggcggcggcggcggcgatggggaaggagttcaagtccaagaacctggaggccgagcggcggaggagggggaggctcaacggcaacatcttcgcgctcagggcggtcgtgcccaagatcaccaaggcaaatgcattcttgagcttcctccccacttttactgaccaccaccagctgattcttgcactgatcatacaaacttcgcataatcagatatgaacctgtttatacttacctaaccctctctcgattctctggaaatcgtgattgcttcaccggggaaaggatttcttgattccggtttgtcattcctgacatgttctgatggttggttttctctgctgttgcagatgagcaaggaggccaccttgtcggacgcgatcgaacacatcaagaatctccagaacgaggttcttgagctgcagcgccagctcggcgactcacccggtgaggcttgggagaagcaatgcagcgcgtcctgctctgaatccttcgtccccactgagaacgcccattatcaggtagcagccgctgttctcaagtagtctatgttttccatcaaagttcacacttcagagagtagtggtctgtactctttagaaccccactgtgcgtccctgggactaattctgaacaaccaatgctgcaatctggaaaatatgatcactcaacttcatacaactttaggcccagattgtttcacaattcgattacatgaagtcgcagtctcgcagacaattggcagatatttgaagctccttaacctttttcgcttaatagacaataaacacacctgaagaagggtgaaaaatctaatccttatttggtttagtagactaatgtccaacttcattgatccacagttagactagccatggacttttgtgagaatttttcaacttacattcagacagagcttgatctcagaaatgacttaacatgaacacaaaaaatattggatacagattcatctatttttctgtgacaaaatttacctctgatatctgattcctcagtctctcaacaatctacatttacacagggtcaggtggaattgatctctcttgggtcatgcaagtataacctgaagatcttctggaccaagagggcaggcctcttcaccaaggtgctggaagcactctgcagctacaaagtgcaagtgctcagcctgaacaccatatccttctacggctacgcagagagtttcttcaccatcgaggtaaactaaatatggccaaaattttcctgctacgacacaagattgcattgcatgtagatttcgctgaactttttaacccattcttgtgagttttagtcttctgataagttggccactcactcctgtctccatctgcaggtgaagggtgagcaggatgttgtgatggtggagctgaggagccttctctccagcattgtggaggttccaagcatctgagacactcctgactacaataaactcacatgactcatgttaagagagcacatatgtttctctggaagaaataattccagtagcagttctctttgtagggagaatacagtggtacatgtttgactgaatgactgatgacatagaagggggaaaaaaggactaaattttgtgttgaaattgagcacagtggcac</dnaseqindica> |
| External Link(s) |